KEGG   Pantoea alhagi: B1H58_13400Help
Entry
B1H58_13400       CDS       T05014                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
palh  Pantoea alhagi
Pathway
palh00061  Fatty acid biosynthesis
palh00780  Biotin metabolism
palh01100  Metabolic pathways
palh01212  Fatty acid metabolism
Module
palh_M00083  Fatty acid biosynthesis, elongation
palh_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B1H58_13400
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B1H58_13400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:palh01004]
    B1H58_13400
Enzymes [BR:palh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     B1H58_13400
Lipid biosynthesis proteins [BR:palh01004]
 Fatty acid synthase
  Component type
   B1H58_13400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ARJ42920
UniProt: A0A1W6B744
LinkDB All DBs
Position
2850186..2851403
Genome map
AA seq 405 aa AA seqDB search
MKRAVITGLGIVSSIGNNQEEVLASLREGRSGITFSQEMKDSGMRSHVWGNVKLDTTGLI
DRKIVRFMSDASIYAYLSMAEAIKDAGLSDETYQNNPRVGLIAGSGGGSPRFQVFGADAM
RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG
KQDIVFAGGGEELCWEMACEFDAMGALSTRYNDTPEKASRTYDANRDGFVIAGGGGMVVV
EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMQGVDTPIDYINTHGT
STPVGDAKELGAIREVFGENQPAISATKAMTGHSLGAAGVQEAIYTLLMLEHGFIAPSIN
VEELDPVAEGMNIVTTPTERQLTTVMSNSFGFGGTNATLTLRKYQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagtgattactggcctgggaatcgtttccagcattggcaacaaccaggaa
gaagtcctggcatctctgcgtgaaggtcgctctggtattaccttctctcaggagatgaaa
gattccggcatgcgtagtcacgtctggggtaacgttaagcttgataccaccggcctcatc
gatcgcaaaatcgtgcgttttatgagtgatgcgtccatttatgcctatctttcaatggct
gaagcgattaaagacgctgggctgagcgatgaaacgtaccaaaataatccgcgtgtgggc
ctgattgccggttccggcggcggttctcctcgtttccaggtgtttggcgccgatgctatg
cgtagcccgcgcggcctgaaagcagtgggtccatatgtagtaaccaaagcgatggcctct
ggcgtttccgcctgcctggcgacgccgttcaaaatccacggcgttaactactccattagc
tccgcctgcgccacttccgcgcactgtatcggtaacgcggtagagcagatccagttgggt
aaacaggacatcgtttttgccggcggcggcgaagagctgtgctgggaaatggcctgtgag
tttgatgccatgggcgcgctgtctacccgttataacgacacgccggaaaaagcgtcccgt
acttatgatgccaaccgtgacggctttgttatcgctggcggcggcggcatggtagtggtt
gaagagctggaacatgcgctggcgcgtggcgcgcatatctacgcagagatcgtgggctac
ggcgcgacctccgacggcgctgatatggttgcaccgtcaggtgaaggcgcagtgcgctgc
atgaaaatggcgatgcagggcgtggatacccctatcgactatatcaacacccacggcacc
tcaacgccggttggcgatgcgaaagagctgggtgcgattcgtgaagtgtttggcgagaac
cagccggccatttccgcaaccaaagccatgaccggtcactccctgggtgccgcaggcgta
caggaagcgatctacaccctgctgatgctggagcacggttttatcgcgccaagtattaac
gttgaagaactggatccggtggcggaaggaatgaacatcgttaccacgccaaccgaacgt
caactgaccacggtgatgtccaacagcttcgggtttggcggcaccaacgcaacgctgacg
ctgcgtaaatatcagtaa

DBGET integrated database retrieval system