KEGG   Pantoea alhagi: B1H58_17495Help
Entry
B1H58_17495       CDS       T05014                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
palh  Pantoea alhagi
Brite
KEGG Orthology (KO) [BR:palh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1H58_17495
Enzymes [BR:palh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B1H58_17495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_3 Thi4 DAO NAD_binding_8 K_oxygenase AlaDh_PNT_C FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ARJ43663
UniProt: A0A1W6B9G6
LinkDB All DBs
Position
complement(3686907..3688475)
Genome map
AA seq 522 aa AA seqDB search
MLDTTMKNQLKAYLEKLTKPVELIATLDDGAKSAEIKELLTEIAELSEKVTFREDNTLPE
RKPSFLITNPGNTTGPRFAGSPLGHEFTSLVLALLQTGGHPSKETQALLDQIRQLDDDLH
FETYYSLSCHNCPDVVQALNLMAILNPRISHTAIDGGVFQSEIQDRNVMGVPAVFLNGKE
FGQGRMSLAEIVSKVDVNADKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTAL
LGERFGGQVLDTVDIENYISVPKTEGSKLAGALKAHVSEYAIDVIDSQSASKLIPASVEG
GLHTIKTASGAELKSRSIIVATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPAMKADAVLQEKVRSLQNVDIILNAQTLEVKGD
GSKLTSLEYKDRVNDTVHQLDVAGIFVQIGLLPNTTWLDGTIERNQMGEIMIDAKCETSV
KGIFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTQPVG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccacgatgaaaaaccaactcaaggcctatcttgagaaattaaccaagcct
gttgagttaatcgctacgctggatgacggcgccaagtctgctgaaatcaaagagttgctg
actgagattgcggagctgtctgaaaaagtaacgttccgtgaagacaacaccctgccggag
cgtaaaccctcattcctgattactaacccaggcaacactaccggcccgcgttttgccggt
tcgccgctgggtcacgaatttacttcgctggtgctggcactgctgcagaccggcggacat
ccgtcaaaagagacgcaggcgctgctggatcagatccgccagctggatgacgacctgcat
tttgaaacctattactcgctttcctgccataactgccctgacgtggtacaggcgctgaac
ctgatggcgattctgaatccgcgcatcagccatacagcgatcgacggcggcgtattccag
agcgaaatccaggatcgcaatgtgatgggcgttcctgcggtattccttaacggtaaagag
tttggtcagggccgcatgagtctggcggagatcgtcagcaaagtggacgttaacgctgat
aaacgcgcggcggaagagctgaataagcgtgacgcttacgatgtgctgattgtcggcagc
ggcccggcgggcgcagcggcagcgatttactcggcgcgtaaaggcattcgtactgctctg
ctgggcgaacgctttggcggacaggtgctggatacggtggatatcgaaaactatatctcc
gtaccgaaaaccgaaggttctaaactggccggcgcactgaaagcgcacgtaagcgaatat
gctatcgatgttatcgacagccagagcgccagcaagctgatcccggccagcgttgaaggc
ggcctgcataccattaaaaccgcctccggcgctgagctgaaatcgcgcagcattatcgtg
gcgaccggcgcacgctggcgtaacatgaacgtgccaggcgaagagcagtaccgcacccgt
ggcgttacctactgcccgcactgtgacggcccgctgtacaaaggcaaacgcgttgcggtt
attggtggcggtaactccggcgttgaagcggcgatcgatctggcaggcatcgttgaacac
gttaccctgctggaatttgctcccgcgatgaaagcggatgccgtgctgcaggaaaaagta
cgcagcctgcagaacgtggacattattcttaatgcgcaaacgctggaagtgaaaggcgac
ggcagcaagctgaccagcctggaatacaaagaccgcgtaaacgacacggttcatcagctg
gacgttgccggtattttcgtacagattggtttgctgccgaacaccacctggctggatggc
accattgagcgcaaccagatgggcgaaatcatgatcgacgcgaaatgcgaaaccagcgtg
aaaggcatctttgctgccggtgactgcaccacggtaccgtacaagcagatcatcatcgcc
agcggcgaaggcgcaaaagcctcactgagcgcgtttgattacctgatccgtactcagccg
gtcggctaa

DBGET integrated database retrieval system