KEGG   Psychrobacter alimentarius: A3K91_0558Help
Entry
A3K91_0558        CDS       T04320                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pali  Psychrobacter alimentarius
Pathway
pali00970  Aminoacyl-tRNA biosynthesis
pali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pali00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3K91_0558
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pali03029]
    A3K91_0558
Enzymes [BR:pali01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A3K91_0558
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A3K91_0558
Mitochondrial biogenesis [BR:pali03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A3K91_0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey RNase_P_pop3
Motif
Other DBs
NCBI-ProteinID: AMT96184
UniProt: A0A144NIE3
LinkDB All DBs
Position
complement(687667..689193)
Genome map
AA seq 508 aa AA seqDB search
MSTATTDNNTVRKETVRKELFVDGYEVVIGIEIHCQLNTESKIFSSSPTDFGHEPNSQAS
LVDLGLPGVLPVLNAGVVDRALKFGIGVNAELGLYNTFDRKNYFYPDLPKGYQITQMANP
IVGKGYIDVVVNEGEKNEYPKRMGITRAHLEEDAGKSVHDAIDGMTGVDLNRAGTPLIEI
VSEPDMRSANEALAYIKAIHQLVTWLGISDAIMAEGSFRCDCNVSVRKPGDELGTRTELK
NLNSFRFIERAINREIERQIDIIEDGGQVIQATMLYDPDRDETRTMRTKEDANDYRYFPD
PDLLPVRIEQHTVDEIKAAMPELPVARRARFEEALGLSEYDARILTGSRQLADYFEDVVA
EVGQQDAKMAANWVMGDLLGALNKDDTDIIDSPISAKQLAGMLARIKDDTLSGKLAKKVF
SALYEREGGDADDAADKIIKDKGLKQETDTGAIKAIVEDVIAKNAAMVEEYRGGKEKAFN
GLVGQVMKASRGSANPQQVNQILKELLG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaactactgataacaataccgttcgtaaagagactgtccgcaaagaactg
ttcgtcgatggatacgaagtggtcatcggcatcgagattcactgccaacttaatacggaa
agtaaaatattttcaagctcgcccacagattttgggcatgagccaaacagccaagccagt
cttgtcgatttgggtctgcctggtgtattgcctgttttaaatgctggcgtggtcgatcgc
gccttaaaattcggtattggcgtcaatgctgaattgggcttgtacaacacatttgatcgc
aaaaactacttttatcctgacttaccaaaaggctatcaaattactcagatggccaaccct
atcgtaggtaaagggtacatcgatgtggtggtcaatgaaggggaaaagaacgaatatcca
aaacgcatgggcatcacccgtgcgcatttagaagaagatgcaggtaaatctgtacatgac
gccatcgatggtatgactggtgtcgatttgaaccgtgcaggtacgccgctgattgagatt
gtctctgaaccagacatgcgctcagccaatgaagccctcgcttatatcaaggccatccat
cagctggtgacttggcttggtatatccgatgcgattatggcagaaggctcgttccgctgt
gactgtaacgtttctgtgcgcaaaccaggcgacgagcttggtacgcgtactgagctaaaa
aacttaaactctttccgcttcatcgaacgcgcgatcaatcgtgaaatcgagcgtcaaatt
gacatcatcgaagacggtggtcaagtcatccaagccacgatgttatatgatccagatcgt
gacgagacgcgcaccatgcgtaccaaggaagatgccaacgactatcgctacttccctgat
cctgatctgctacctgtccgcattgagcagcatactgttgatgaaatcaaagcagctatg
cctgaattaccggttgctcgtcgcgcacgctttgaggaagcacttggtctatcagaatat
gacgctcgtatcctaaccggaagccgtcagctggccgattacttcgaagatgtcgtcgct
gaagtgggacaacaagatgcaaagatggctgccaactgggtcatgggcgacttactgggc
gcgctgaacaaagatgatacggatatcattgactcgcctatcagcgccaagcaattggcg
ggtatgctggcgcgtatcaaagacgacactttatctggtaaattggcaaagaaagtcttt
agcgctttgtatgagcgcgaaggcggcgatgccgatgatgcagcagataaaatcatcaaa
gacaaaggcctcaagcaagaaaccgatacgggcgcgattaaagccatcgtggaagacgtc
atcgctaaaaatgcagccatggtcgaagagtatcgcggcggtaaagaaaaagcctttaat
ggtctggttggacaagtgatgaaagccagtcgcggtagcgccaacccgcagcaagtcaac
caaatcctaaaagagctgttgggctaa

DBGET integrated database retrieval system