KEGG   Psychrobacter alimentarius: A3K91_0599Help
Entry
A3K91_0599        CDS       T04320                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
pali  Psychrobacter alimentarius
Pathway
pali00061  Fatty acid biosynthesis
pali00780  Biotin metabolism
pali01100  Metabolic pathways
pali01130  Biosynthesis of antibiotics
pali01212  Fatty acid metabolism
Module
pali_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pali00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A3K91_0599
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A3K91_0599
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A3K91_0599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pali01004]
    A3K91_0599
Enzymes [BR:pali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     A3K91_0599
Lipid biosynthesis proteins [BR:pali01004]
 Fatty acid synthase
  Component type
   A3K91_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 Sacchrp_dh_NADP DUF1776 LDcluster4
Motif
Other DBs
NCBI-ProteinID: AMT96224
UniProt: A0A144NJI4
LinkDB All DBs
Position
715880..716608
Genome map
AA seq 242 aa AA seqDB search
MSRTITLVTGASRGIGKAVAKRFAKEGHFVIGTATSEKGAELINDYLHDTGGIGRVLDVR
DSAQIDKLFEEIESVYGAVQVLVNNAGITQDGLLMRMKDEDWSNVIDTNLTSIYRMSKRA
VRGMMKARRGRIINITSVVAQMGNAGQSNYAATKAGVEGFSRTLAREIGSRQVTINCVAP
GLIETDMTDELDERLLNSMLDAVPISRLGQPEDIAAAVHFLASDEASYITGAVIPVNGGM
YM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtacaattacattagtcactggtgctagccgtggtatcggtaaagccgttgct
aaacgttttgctaaagaaggtcattttgtcattggaacagcgactagtgaaaaaggggct
gaacttatcaacgattatcttcatgataccggtggtattggtcgagtcttagacgttcga
gatagtgcacagattgataaattatttgaagaaattgaaagtgtttatggtgcagtacaa
gtgttggtaaacaatgcaggtattacccaagatggcttattaatgcgtatgaaagacgaa
gattggagcaatgtgattgacaccaatttgacctcaatttaccgtatgagcaaacgtgct
gtgcgtggcatgatgaaagcacgccgtggacgtattattaatattacttctgtcgtcgca
cagatgggcaatgctggtcaatctaactacgctgcgaccaaagcaggggttgaaggtttc
agccgtactttggcacgtgagatcggttcaagacaagtcactatcaattgcgtagcacca
ggtttgattgagacagatatgactgatgagcttgatgagcgtctactaaactctatgttg
gatgcggtgcctatcagtcgtcttggtcagccagaagacattgctgcagcggtgcatttt
ttagcaagtgatgaagcgagttatattacaggtgcggtcattcctgtaaatggtggcatg
tatatgtag

DBGET integrated database retrieval system