KEGG   Psychrobacter alimentarius: A3K91_1253Help
Entry
A3K91_1253        CDS       T04320                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pali  Psychrobacter alimentarius
Pathway
pali00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3K91_1253
Enzymes [BR:pali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A3K91_1253
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A3K91_1253
    1.1.1.-  
     A3K91_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C FAD_binding_3 Semialdhyde_dh ADH_zinc_N_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AMT96859
UniProt: A0A144P4K3
LinkDB All DBs
Position
1530069..1531133
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVEPGTVGIDVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYEVGEGVDDIEVGQHVVVEPYIIADDVSTAEGENYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNDIPLDQAALIEPLSVGYHAFVRSGAQAGDVALVG
GGGPIGLLLASVLKAKGLTVILTELSAKRKDKARESGVADYILDPTEVDLKEEVMKITDN
RGADVAFECTSVNAVLDSLVELTKPAGVVVIVSIWSHPASINVHSVVMKELDIRGTIGYV
NNHKDTIKLVEDGLVDLEPFITQRIKLDDLISEGFETLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcacgtttttatgacaaaggtgacatccgtatcgaagatatcccagaacct
accgttgagccgggtactgtgggtatcgacgtggcatggtgcggtatttgcggcacggat
ttgcatgagtttatggaaggccctatctttattccgccgtgtggtcatccgcatcctatc
tcgggagagtctgcgcccatcacaatggggcacgagttctcaggagtagtatatgaagtc
ggtgaaggcgttgatgatattgaagttgggcaacatgtggtagttgagccatatatcatt
gctgatgatgtttctaccgccgaaggagagaactatcatttatcaaaaaacatgaatttt
attggtttgggtggacgcggcggcggcttatctgaaaaaatcgcggtcaaacgtcgctgg
gtacatcctatctcaaatgatattcccttggaccaagcagctcttattgagccattatct
gtcggctatcatgcctttgtccgtagtggtgcgcaggcgggtgatgtggcactggtcggc
ggcggtggccccattggtctgttactggcttcggtattaaaagccaaaggtttgaccgtc
atcttgactgagctgagcgccaagcgtaaagacaaagcccgcgaaagtggggttgccgat
tatatcttagaccctaccgaagtcgatttaaaagaagaggtgatgaaaatcacggacaat
cgcggcgcggacgtggcgtttgaatgtaccagtgtcaacgcggtgctcgactcattggtt
gagctgaccaaacctgctggcgtggtagtgattgtctctatttggagtcatccagcctcc
atcaacgtccatagcgtagtgatgaaagagctagatattcgcggcaccatcggctatgtg
aacaaccataaagacaccatcaagctggtcgaagatggtttggttgatcttgagccattt
attactcagcgcatcaagttggatgatttgatttcagaaggctttgaaacgctgattcac
aacaatgagtctgcggtaaaaatcatcgtgaatccaaatctataa

DBGET integrated database retrieval system