KEGG   Psychrobacter alimentarius: A3K91_2317Help
Entry
A3K91_2317        CDS       T04320                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pali  Psychrobacter alimentarius
Brite
KEGG Orthology (KO) [BR:pali00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3K91_2317
Enzymes [BR:pali01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A3K91_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_oxidored FAD_binding_2 NAD_binding_8 Thi4 DAO K_oxygenase AlaDh_PNT_C NAD_binding_7 FAD_binding_3 Shikimate_DH Lycopene_cycl ABC_transp_aux 3HCDH_N Glutaredoxin Thioredoxin_14 ThiF DSBA
Motif
Other DBs
NCBI-ProteinID: AMT97893
UniProt: A0A144Q2S7
LinkDB All DBs
Position
complement(2807016..2808593)
Genome map
AA seq 525 aa AA seqDB search
MIDQALLDAVKSYSENMTRPITFVLGSGEHNKRAELIDFLTKIAGTTDKINFDAEATDDS
LSSAISFKVVSHIDGESADTGIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKLVKR
FNKPLQFQTYVSLSCHSCPEVVQALNQFALLNDDISNEMIDGALFQEQVEANKIQGVPAV
FLNGKPFANGLIDTAKLIGKLQEQFPDLLADVEDDAEQLEQQDVTIIGAGPAGVAAAIYT
ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTNGTDLSTNFVKHLSEYNITLKEHVSVK
DIGETEEENYSINLNTGESFETRSIILATGAQWRKLGVPGEEENIGKGVAFCAHCDGPFF
KGKDISVIGGGNSGVEAALDLAGIVKHVTVLEFADELKADQVLINKAKEKSNIEFITGAA
TQEIKATDGKVSSIVYQDRSTGETHERDLSGVFVQIGLVPNTGFIKGFVDLNRFGEIEID
ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatagatcaagcattattagatgccgtaaagagctatagcgaaaacatgactcgtcct
attacctttgtattgggtagtggcgaacataacaagcgtgctgaattgattgatttttta
accaaaattgcaggtacgactgacaaaattaacttcgatgcagaagcgactgacgatagt
ttgtcgagcgcaattagtttcaaagtagtcagtcacattgatggagaatcggctgataca
ggtatcgtatttagcggtattcctggtgggcatgaatttacgtcattgattttggcaatc
ttgcaagctggcggtcacaccttaaagttggatgaaggtatccaaaaattagttaagcgt
tttaataagccattgcagtttcagacatatgtatcattgtcttgccacagctgtcctgaa
gtggtgcaagccttgaatcagtttgcgttactcaatgacgacatcagcaacgagatgatt
gatggtgcattgttccaagaacaagtagaagcgaacaaaatccaaggtgtaccagcggta
tttttaaacggaaaaccgtttgccaatggtttgatcgacacggctaaattaatcggaaaa
ctacaagaacagttcccagatttgttggcagacgtcgaagacgatgctgagcaattggaa
cagcaagatgtcactatcatcggtgctggtcctgcaggcgttgcagcagccatttacaca
gcacgtaaaggtcttaaagttacaatggtcgctgatcgtatcggtgggcaggttaaagac
acgcaagatatcgaaaacctgatctctgtgcctttgaccaatggtactgacttatcgacc
aatttcgtcaagcatttatctgaatacaacatcacgctaaaagagcatgtgagtgtcaaa
gatatcggcgagacggaagaagaaaactacagcatcaacctaaatactggtgagtcgttt
gaaacgcgtagtattatcttagcgacaggtgcccagtggcgcaagcttggtgtaccgggt
gaagaagaaaacatcggtaaaggcgtggcgttttgtgctcactgtgatggtccattcttt
aaaggcaaagacatctcagtcattggcggtggtaactcaggtgttgaggctgcattagat
ttggctggtatcgtcaagcatgtcaccgtgctagagtttgctgatgagttaaaagcggat
caagtattgattaataaagccaaagaaaaatctaatatcgaatttatcactggtgccgcg
acccaagagatcaaagcgactgacggtaaagtgtcttctatcgtttatcaagatcgcagc
acgggtgaaactcatgagcgtgatttatcaggcgtgtttgtacagattggtttagtgcca
aacactgggtttatcaaaggttttgtcgatttaaaccgttttggtgaaattgagattgat
gagcgctgccgcaccgatcgtaaaggtatttttgcttgtggtgatgtgacaaccgtacca
tttaagcaaatcaatattgcaatgggtgaaggtagtaaagcggcactgtcagcgtttgaa
tatttggttatgcagtaa

DBGET integrated database retrieval system