KEGG   Pseudomonas alkylphenolica: PSAKL28_32170Help
Entry
PSAKL28_32170     CDS       T03238                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
palk  Pseudomonas alkylphenolica
Brite
KEGG Orthology (KO) [BR:palk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSAKL28_32170
Enzymes [BR:palk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSAKL28_32170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 Glutaredoxin NAD_binding_7 FMO-like Thi4 K_oxygenase NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AIL62384
UniProt: A0A077FEE3
LinkDB All DBs
Position
complement(3539594..3541156)
Genome map
AA seq 520 aa AA seqDB search
MLDATLKTQLKAYLERVTQPIEIVASLDDGAKSRELRDLLVEIASLSTLITLREDGSDAR
RPSFSLNRPGGDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASLEVIEQISALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVESRKVMAVPSVYLNGEVF
GQGRMGLEEILAKLDTSAGERQAEKINAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAMALEEHVKQYDVDIMNLQRGEALIPATDGGL
HEVRLASGASLKAKTVILATGARWREMNVPGEKEYRSRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVLGDGE
KVNGLRYKDRNNDVLHDIALEGIFVQIGLLPNTDWLKGTLELSPRGEIIVDARGQTNLPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaaactcagttgaaagcctacctggagcgggtcactcagccg
atcgagatcgttgcttccctcgacgacggcgcgaagtcccgcgaattacgcgacctgctg
gtggaaattgccagcctgtccaccctgattaccttgcgtgaggacggcagcgacgcgcgt
cgcccttcgttctcgctcaaccgcccggggggcgatatcagcctgcgctttgccggtatc
cccatgggccacgaattcacctcgctggtgctcgccctgctgcaggtcggcggtcatccg
tccaaggccagcttggaggtgatcgagcagatcagcgcccttaaaggtgagttcagcttt
gaaacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgttgaacctg
atggcggtgctcaaccctaatatccgccatgtcgccatcgatggcgcgttgttccaggcc
gaagtggaatcgcgcaaagtcatggccgtgccgagtgtctacctcaacggcgaagtgttt
ggccagggtcgcatggggctggaagagatcctcgccaagctcgataccagtgccggtgag
cgtcaggccgagaagatcaacgccaaagatgccttcgatgtactggtggtaggcggtggc
ccggctggcgccgcagcggcgatctacgcagcacgtaaaggtatccgtaccggcgtggcg
gcagaacgtttcggcggtcaggtgctcgacaccatggccatcgagaacttcatctcggta
caggaaaccgaaggcccgaaactggccatggccctggaagagcacgtcaaacagtacgac
gtcgacatcatgaacctgcagcgtggcgaagcgctgattccggccaccgacggcggcctg
cacgaagtgcgtctggccagtggcgcttcgctcaaggccaagaccgtgatcctggccacc
ggtgcccgctggcgcgaaatgaacgtgccgggcgagaaggaataccgcagccgtggcgtg
gcctactgcccgcactgcgatggcccgctgttcaaaggcaagcgtgtggcggtgatcggt
ggtggcaactcgggcgtggaagcggctattgacctggcaggtatcgttgcccaggtgacg
ctgatcgagttcgacagccagttgcgtgccgacgccgtattgcagcgcaaactgcacagt
ctgccgaacgtgaaagtgatcaccagtgcactgaccaccgaagtgctgggcgacggcgag
aaggtcaatggcctgcgctacaaggaccgcaacaatgacgtactgcatgacatcgcgctg
gaagggatcttcgtgcagatcggtctgctgcccaacaccgactggctcaaaggcacgctc
gaactgtcgccgcgtggtgagatcattgtcgatgcccgtggccagaccaacctgccaggt
gtgtttgccgcaggtgacgtgaccaccgtgccgtacaagcagatcgtgattgcggtaggc
gagggggccaaggcgtcactggcagcctttgatcacctgatccggacttcggcaccagcc
tga

DBGET integrated database retrieval system