KEGG   Pseudoalteromonas aliena: B0W48_03475Help
Entry
B0W48_03475       CDS       T04815                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
paln  Pseudoalteromonas aliena
Brite
KEGG Orthology (KO) [BR:paln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B0W48_03475
Enzymes [BR:paln01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B0W48_03475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO NAD_binding_8 Thi4 FAD_binding_3 NAD_binding_9 K_oxygenase Lycopene_cycl Glutaredoxin Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: AQP98938
UniProt: A0A1Q2GUY5
LinkDB All DBs
Position
790160..791740
Genome map
AA seq 526 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSAEVESLANDLASLSDKFTVINNPDTSA
RRPSMVVHSPIKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKSEDIEQIQSLTQELN
FEVYISLSCQTCPQVVQALNTMAATNSNIKATMIDGALFQGEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAQRQAESLSKKDKFDVLVIGGGPAGASAAIYSARKGLNTGI
VADRFGGQVADTLAIENFISIKATEGPKLVAQLEEHVKEYDVDVMHNQRAAALGYNNGYE
ITLENGAVLKAKSLVLATGARWREMNVQGEQEYRGHGVAYCPHCDGPLFKGKPVAVIGGG
NSGIEAAIDLANIVQSVTVLEFADTLRADEVLVRKAKSMANITIIKSAQTTEVLGDGKKV
TGLTYIDRVSGESKELELAGIFVQIGLIPNTEWLKDSDLELSKFGEILIDDKGATSLPGI
YGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSDETEQDQSAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacataaaaaatcaattaaaaagccattttgaatcgcttactcaacct
gttgagctgcttattgccttggatgacagcaaaaaatcagcagaggtagaaagcttagca
aacgatttagcctcactgagcgataaattcacggtaataaacaaccctgatacgagcgca
cgtcgtccgtcaatggttgtacattcaccaattaaaaacactcatattacgtttgcaggc
gtacctatgggtcacgaattcactagtttagtgttagcacttttacatacaggcggacac
gcaagtaaagccaaaagcgaagacattgagcaaatacaatcgctcactcaagagctcaac
tttgaagtatacataagtttaagttgccaaacgtgcccgcaagtagtgcaagcacttaat
actatggcagcgacaaacagcaatattaaggcgaccatgattgatggcgcgttatttcaa
ggcgaagtggaagagcgaaatattttagctgtaccggctgtatatttaaatggcgaacca
tttagccaaggtgcactaagccttaccgacatacttaataaagtagatagcaaaggggca
cagcgccaagctgagtcgctaagcaaaaaagataaatttgatgtacttgtcattggtggc
gggcctgcgggcgcatcggctgcgatttactcagcgcgaaaagggttaaatacaggtatt
gttgccgaccgctttggtggacaagttgcagatacattagcaatagaaaactttatttcg
attaaggcgacagaagggccaaaattggttgctcagcttgaagagcacgttaaagaatac
gatgtagatgtaatgcataatcagcgggcagcggcacttggttataacaatggttacgaa
attacacttgaaaacggcgcagtacttaaagctaagtcgctcgtacttgcaactggcgca
cgctggcgcgaaatgaacgtacaaggtgagcaagaatatcgtggacacggtgtggcatat
tgtccacattgcgatggccctttatttaaaggtaagccagttgcggtaattggcggtggt
aactcaggcatagaagcggcgatagatttagccaatattgtgcaaagcgttacggtactt
gaatttgcagacacattacgtgctgatgaagtactcgttcgtaaagctaaaagcatggct
aacattactattatcaaaagtgcacaaacaaccgaagtgcttggtgatggtaaaaaagta
acaggcttaacgtacatagatagagtgtcgggggagagcaaagagcttgaacttgccggt
atatttgtacaaataggcttaataccaaataccgagtggttaaaagacagcgaccttgag
ctaagcaaatttggtgaaatactgattgatgataaaggcgcaacttcgttaccgggtatt
tatggcgcgggggatgcgaccaatactccgtttaaacaaattattattgcaatgggcagt
ggtgcaacggcaagcttaggcgcatttgattatttaattcgccacagcgatgaaaccgaa
caagatcaaagcgctgcttag

DBGET integrated database retrieval system