KEGG   Pseudoalteromonas aliena: B0W48_11785Help
Entry
B0W48_11785       CDS       T04815                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00250  Alanine, aspartate and glutamate metabolism
paln00410  beta-Alanine metabolism
paln00430  Taurine and hypotaurine metabolism
paln00650  Butanoate metabolism
paln01100  Metabolic pathways
paln01110  Biosynthesis of secondary metabolites
paln01120  Microbial metabolism in diverse environments
paln02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B0W48_11785
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B0W48_11785
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B0W48_11785
   00430 Taurine and hypotaurine metabolism
    B0W48_11785
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B0W48_11785
Enzymes [BR:paln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B0W48_11785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AQQ00415
UniProt: A0A1Q2GZ94
LinkDB All DBs
Position
2628473..2630098
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAVIPEDPTFVSAYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQEDSFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLFKPDGDFRGIGAQGLIAGMLHYGYKGLAVLISERGHYSLGKSVDLLGIGRENL
IGIKTSEDNKVDVGAMREKALELESQGIKVMAIIGVAGTTETGNIDPLNEMADLAEQINC
HFHVDAAWGGATLLSTTHRPLLKGIERADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKAHYFADLI
KADEDFELISEPELCLLTYRYVPKKIKQAIAEADAATRLDIFASLNRFTASMQKRQRESG
RSFVSRTRLTPSKYDNQPTVVFRVVLANPLTSGAILKDILAEQKELAKTDPVFKKYLRKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaagcgtatatttactgta
cctgaagcgccagactcaactttaagcaaaatcgagcttgaaatttcgagtaatttagca
ggtttcttaaacgaaaatattgcggcaattgaaaaaccattacatgaaattgaaaaagat
tttcaatcggctgttatccctgaggatccaacgtttgtgtctgcttatgcacaggacata
atggagcagctcgttgcgcattcagtgcataccgcagcccccagttttataggtcatatg
acttcggctttgccacattttttattaccgctgtcaaaattgatggtggggctaaaccaa
aacctagtaaaaatagaaacgtctaaagcatttacacctcttgagcgccaagtgcttgga
atgatgcatcatttagcttatgggcaagaagactcattttattctaaatggatgcacagc
gctaaaacctctctcggtgctttttgctcaggtggtacggttgctaatattactgcgctt
tggattgcacgaaaccgcttattcaagcctgatggtgattttagagggataggcgcacaa
ggcttaattgctggtatgctgcattacggatacaaaggtttagcggtattaatatcagaa
cgtggacattactcgttaggtaaatcggtagatttattaggtatcggtcgcgaaaattta
ataggcattaaaaccagcgaagataataaagtcgatgtaggagcgatgcgtgaaaaggct
cttgagctagaatcgcaaggcattaaagtaatggcaattattggggtcgccggtacaacc
gaaactggaaatatagatccccttaatgaaatggccgatttagcagagcaaatcaattgt
cattttcatgtcgatgcagcatggggaggagcaacacttttatcaacgactcatcgccct
ttattaaaaggcattgaacgcgctgattcaatcaccattgatgcgcacaaacaaatgtat
gtaccaatgggggcaggtttggttttatttaaagaccctgcggcaaccgatgcgatagaa
caccacgcagagtatattttgcgtaaaggctctaaagacttaggtagtcacacgcttgaa
ggtagtcgtcctggaatggcgatgttagtgcatgcttgcttacgtgttattggtcgtaaa
ggctacgaaatgttgatcgatcgaagcattaaaaaggcgcactattttgctgatttaatt
aaagccgacgaggatttcgaacttatttcagagcccgagttgtgtttattaacataccgc
tacgtacctaaaaaaataaaacaagcaatagctgaagcagatgctgcaacgcgtttagat
atttttgcatcattaaatcgctttactgccagcatgcaaaaaaggcagcgtgaatcaggt
cgctcgtttgtatcacgtacgcgcttaacaccttctaaatatgataaccagccaaccgtt
gtatttagggttgtacttgcaaacccacttacatcgggggctattttaaaagatatttta
gctgagcaaaaagaattggctaaaaccgatcccgtgttcaaaaagtatttaagaaagtac
atgtag

DBGET integrated database retrieval system