KEGG   Pseudoalteromonas aliena: B0W48_15835Help
Entry
B0W48_15835       CDS       T04815                                 

Definition
(GenBank) hydrogen cyanide synthase
  KO
K10816  hydrogen cyanide synthase HcnC [EC:1.4.99.5]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00460  Cyanoamino acid metabolism
paln01100  Metabolic pathways
paln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    B0W48_15835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:paln02042]
    B0W48_15835
Enzymes [BR:paln01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.99  With unknown physiological acceptors
    1.4.99.5  glycine dehydrogenase (cyanide-forming)
     B0W48_15835
Bacterial toxins [BR:paln02042]
 Not specified
  Hydrogen cyanide production
   B0W48_15835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox FAD_binding_2 HI0933_like Thi4 Pyr_redox_3 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AQQ01110
UniProt: A0A1Q2H181
LinkDB All DBs
Position
3549912..3551123
Genome map
AA seq 403 aa AA seqDB search
MKKFDIVIAGGGVIGAACAYFLSRDTDLKIALIDIKKPGNASRASAGGLWAIGESVGLGC
GVIFFKTLSKLQSEANGKEIPVMRPHQLPDCFFEFALTSNDMYPALHQEMLDRHGVDFKF
ERTGLKFIMYNEDDRIYADQITSGIPHLADQIRWLDAEQLKEEEPYITPDAIGAIDFICD
HQVNPYRLVDAYTESARQNGVELVLNTEVTSVIREGSRVMGVETTLGSFQCDTLINAAGA
WADELFHKATGYNMPVYPVKGQIVLSERMPKILNGCISTSDCYIAQKDNGEILIGSTTEE
KGFDTTNTLDKITELSQGAMKCLPILKESNIKRCWAGLRPGTPDELPILGEVPGIEGYLN
ACGHFRTGILTSAITGKLITELVKGQPTSLDLTPFSVVRFLEG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgatattgtaattgccggtggcggcgttattggtgctgcatgcgcttat
tttttaagccgagatacagatttaaaaattgctttgattgatattaagaaacccggcaat
gcttcgcgagcatctgctggtggcctatgggcaattggtgagtcagttggacttggatgc
ggcgttatattctttaaaacgttatctaagttgcaaagtgaagctaatggtaaagaaatt
cctgtcatgcgacctcatcagttacctgattgtttttttgagtttgcattaacatcaaat
gatatgtatcccgctctgcatcaagaaatgttagatcgtcatggcgttgattttaaattt
gaacgcacaggcttgaaatttatcatgtataacgaagatgacagaatttatgctgatcag
atcaccagcggtattcctcatctggcagatcaaattaggtggttagatgctgaacagtta
aaagaagaagagccttatataacacctgatgctattggtgccatcgattttatttgtgat
catcaagtaaatccttaccgcttggttgatgcatatacggaaagcgcacgtcaaaacggt
gttgagctagtactcaatacagaagtaacatctgtgattcgagaaggaagtcgagttatg
ggagttgaaacaacattgggtagttttcaatgtgatactttgatcaatgcagctggtgct
tgggctgatgaattatttcataaagccactggatacaatatgcctgtttatcctgttaaa
ggacaaattgtgttgtctgaacgtatgcctaagattcttaatggctgtatcagtaccagt
gattgttatattgcgcaaaaagacaatggcgagatattgatcggttcaacgaccgaagag
aaggggtttgatacgacgaatacactagataagataacggagctttcacaaggagcaatg
aaatgtttacctatcttaaaagaaagtaatattaaacgttgttgggcagggttacgccct
ggtacgccagatgagctacccattttaggtgaagtgcctggaattgaagggtatttaaat
gcatgtggacattttagaacgggtattttaacttcggctattactggaaaattaataact
gaactagtgaaaggtcagccaactagcttggatttgactccatttagtgttgtgcgtttt
ttagagggctaa

DBGET integrated database retrieval system