KEGG   Pseudoalteromonas aliena: B0W48_16200Help
Entry
B0W48_16200       CDS       T04815                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00500  Starch and sucrose metabolism
paln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B0W48_16200
Enzymes [BR:paln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B0W48_16200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Asp_protease TPR_6
Motif
Other DBs
NCBI-ProteinID: AQQ01176
UniProt: A0A1Q2H1D0
LinkDB All DBs
Position
3636610..3639018
Genome map
AA seq 802 aa AA seqDB search
MKNYNLITISLLALGLTACGAQNTNQSQTVQTSKTTAPGAPGNDPFWSYAGKTGIGTSYE
QYQNGHYTSDAPTGVVSKVWFSIAKGMITETMFGLIHQAQIKDMQFVVTGKDFTVSEADD
LDVTIDYLYKDEQGRPLSLAYKIVSKDKQGRFTLEKHVFTDPDGQSLFVRSVFNTDLKDV
KAYVVVNPYINNNGLDDFAKTTEQGLVAWQGDNYLTLQASTEFGTKTVGFTGVSDGLDEL
KKSQSLNTSYSNTGEQSGNVSLLAELGSIESNTTFDLVLSFARSEQQSAEQGAQTLAKGY
QSVLDSYNGKGAAFGWQDYLQSLAPINKMTEQTADNGKLLFTSAMVLKAQEDKTHAGALI
ASLSNPWGETVSAKTGSTGYKAVWVRDFYQVAMAFMALGDTATAKTAFEYLEKVQVSSKT
PGNNGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLHQANVLSDAELKDWYARMLK
PAADFLVDGGLAKILWNDTQITPPATQQERWEEQSGYSPSTTAAVVAGLISAADIANMAG
DTKNAERYLATAKSYNADIEKVMFTTQGNLESKATDGEYFIRIGQDENANSNTTINANNG
REGFNKKQILDGGFLELVRYGVRDALAPSIVKTLPEYDDETLADNLQVKYSFNFSDGSGS
FAGYRRYGNDGYGEDEVTGTNYAENGSNTPGQRGRVWPFFTGERGHYEIAAANASNTFND
VKQAEIKNSYVKGLEQFANEGMMLPEQVWDGVGVNKAGYTLGEGTNSATPLAWTHAEYIK
LVRSLSDKQVWDHYPVVKQALK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactataacctaattactatctcactattagcacttggattaactgcatgcggt
gctcaaaatacaaatcagtcacaaacagtacaaacatctaaaacaactgcgcctggtgca
ccaggtaacgacccgttttggtcatacgcaggtaaaacagggattggcacatcgtacgag
caataccaaaatggtcattacacaagtgatgcaccaacaggtgtagtatcaaaagtctgg
ttttcaattgctaaaggcatgatcaccgaaactatgtttggccttattcatcaagcacaa
ataaaagatatgcaatttgtggtaacaggaaaagactttactgttagcgaagcagacgat
cttgatgtcacgattgattatctatacaaagacgagcaaggccgtccgttatcacttgct
tataaaatagtaagtaaagataaacaaggcagattcactcttgaaaaacacgtatttacc
gatcctgatgggcaaagtttatttgttcgtagcgtatttaataccgaccttaaagacgtt
aaagcctatgttgtggtaaatccatatattaataataacggccttgatgattttgcaaaa
actaccgagcaaggtttagttgcttggcaaggtgacaattacttaacattgcaagcaagc
actgaatttggcacaaaaacggttggctttacgggtgtgagtgatggtttggatgagctc
aaaaagtcacaatcattaaataccagttatagcaatactggtgagcagtcaggtaatgtc
agtctgcttgctgagcttggtagtattgaaagtaataccacgtttgatttagtactaagc
tttgcacgtagcgagcaacaaagtgcagagcagggcgcccaaacattagcaaaaggctat
caaagtgtacttgatagctacaatggtaaaggtgcggcatttggttggcaagattaccta
caaagcctagctccgatcaataaaatgacggagcaaacggccgataacggcaagctactt
ttcaccagtgcaatggtattaaaagcacaagaagataaaacgcatgcaggcgcacttatt
gcgtcgttgtctaacccgtggggcgaaaccgtatcggctaaaacaggctcaactggttat
aaagcggtgtgggtacgagatttctaccaggtggccatggcgtttatggcactgggtgat
acagccacggcaaaaacagcatttgaataccttgaaaaagtacaagttagtagtaaaacg
ccaggtaacaatggcgatacaggctggtttttacaaaaaacacatgtcgatggcgaactt
gaatgggtgggtgtacagcttgatcaaactgcgatgccaattatgctcgcgtggaaatta
caccaagcaaatgtacttagtgatgcagagcttaaagactggtatgcacgtatgttaaaa
ccagcggctgattttttagttgatggcggccttgcaaaaatcttatggaatgacacgcaa
attacaccaccggcaacacaacaagagcgctgggaagagcaaagtggttattcgccttca
actactgcagcggttgttgcgggtttaattagcgccgcagatatcgcaaatatggcaggt
gatacaaaaaatgcagaacgttatttagcaacggcaaaaagctataacgctgacatcgaa
aaagtgatgtttaccacccaaggtaatttagaatcaaaagctaccgatggcgaatatttc
attcgtattggtcaagatgaaaatgccaactccaataccacaattaacgcaaacaacggt
cgagaaggctttaataaaaaacagattttggacggtggctttttggagttagtacgctac
ggggtacgtgatgcacttgcaccaagcattgtaaaaacgctaccagaatacgatgacgaa
acactcgctgacaatctgcaagtaaaatatagctttaactttagcgatggtagtggctca
tttgcaggttatcgtcgttatggcaacgatggctatggcgaagatgaagtaaccggtaca
aattacgctgaaaatggaagtaatacacctgggcaacgcggacgtgtatggccatttttt
acaggcgaacgtggtcattatgaaattgcagcagccaatgccagtaatacattcaatgac
gtaaaacaagctgaaattaaaaacagttacgttaaagggctagagcaatttgccaatgaa
ggcatgatgttaccagagcaagtatgggacggcgttggtgtaaacaaagcaggttataca
ctgggcgaagggactaattcagcaactccgctggcatggactcacgctgaatatattaag
ctggtacgttcattaagtgacaagcaagtatgggatcattaccccgttgttaaacaagcg
ctaaaatag

DBGET integrated database retrieval system