KEGG   Candidatus Portiera aleyrodidarum MED: O3E_00905Help
Entry
O3E_00905         CDS       T03834                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
paly  Candidatus Portiera aleyrodidarum MED
Pathway
paly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paly01100  Metabolic pathways
paly01110  Biosynthesis of secondary metabolites
paly01130  Biosynthesis of antibiotics
paly01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3E_00905
Enzymes [BR:paly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     O3E_00905
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     O3E_00905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: AJF24089
UniProt: A0A249E0P6
LinkDB All DBs
Position
complement(176004..177083)
Genome map
AA seq 359 aa AA seqDB search
MNKKFKPYIKYIGNIDYQILKLISHRAKLVSQIQLADDKQNCSYNNGHEDRYFYSIKTSN
KGPLSNKVLSKIFKSIVSACLKFKKKSQVAYLGPEGTFTQQAVLKYFGKSIKSIPVKDVF
RTIENKIYNYGVVPVENSTEGIVNNTFDSFISSNLKICGEIILSIHHHLLIDKQNINKNI
DKIYSHQQSFSQCRDWLKNNYPNAKKIAVASNAEASNLTQYKKNSAAIAGDLAASYYSLI
KLAKNIEDRINNYTRFLILSDKDVAPTGYDKTYLMIYINNQIGSFYLLIEPFYRYNINIL
RLTTRPAPENKGVWNYIIFLEIKGHRKSKLVEKTLEEIYLRGAELKILGSFPEQLTKRI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaatttaaaccctatataaaatacattggtaatattgactatcaaatatta
aagttaattagtcaccgtgctaaattggtttcacaaattcaattggcagacgataaacaa
aattgtagttataacaatggtcatgaagaccggtatttttatagtattaaaacaagtaat
aaaggaccactgtctaataaagtattatctaaaatttttaaatctattgtatcggcttgt
ttaaagtttaaaaaaaaaagtcaagtagcatatttaggtccagagggcacttttacccaa
caagcagtattaaaatattttggtaaatcaataaaaagtatacccgttaaagatgtgttt
agaacaatagaaaacaaaatatataattatggggttgtaccagtagaaaattcaacagaa
ggcatagtgaataatacttttgattcatttattagttcaaacttaaaaatatgtggtgaa
ataatattatctatacatcatcatttgttgattgataaacagaatataaataaaaacata
gacaagatttattcgcatcaacaatcattttctcagtgtagagattggttgaaaaataac
tatccaaatgcaaaaaaaattgcagtggcttctaatgcagaagcttcaaatttaacacaa
tataaaaaaaatagtgcggcaattgctggagatcttgctgctagttattattctttaatt
aaacttgctaaaaatatagaagatcgtataaataattatacaagatttttaatattgtct
gataaagatgttgcaccaacaggttatgataagacttatttgatgatatatataaacaat
caaataggttctttttatttgttaatagaacccttttatcgttataacataaatatctta
cgcttaacaactagacctgcaccagagaataaaggagtttggaactacataattttttta
gaaataaaaggacatcgtaaatctaaattagtagaaaaaactttagaagaaatttatctg
cgtggtgcagaacttaaaatattaggttcatttccagaacaattaactaagagaatataa

DBGET integrated database retrieval system