KEGG   Pantoea ananatis LMG 20103: PANA_0572Help
Entry
PANA_0572         CDS       T01195                                 

Gene name
tdh
Definition
(GenBank) Tdh
Organism
pam  Pantoea ananatis LMG 20103
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADD75739
UniProt: D4GIZ4
LinkDB All DBs
Position
655112..656158
Genome map
AA seq 348 aa AA seqDB search
MSMKAAVLFEANKLDVIHVDAPKAAQGELVMRVKSAAICGTDSRIITGRKTKGVRFPSVI
GHEFAGEVVEVGQDVTRFSISDRIAVDPVIPCRSCLYCRSGKENVCQHRQAIGYEFDGAF
AEYVKIPAIALEAGNVFKLPDSVSYDAAALAEPLACCINGQKNVGIHLGDVVVILGAGPI
GLMHVALAKRSGASKIIVSDLNENRRSVALQCGASHAVDASQQDLKAIVMSETSGLGADV
AIMAIGLPALVNPSLELLRKGGRANLFAGFSKEDTADVDVNLIHYNELVITGASALSREG
YEKALGLISSGQINVEALITHRFSLSEISEALRYAQKGDAVKVIIHND
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgaaagcagcagtgctattcgaggccaacaaacttgacgtgattcacgttgat
gcgcccaaggccgcgcaaggtgagttggtcatgcgtgttaaatcagcggcgatctgcggt
acagacagccgcatcataaccggcaggaaaacaaaaggggtacgttttccttcggttatc
gggcatgagtttgcaggtgaagtggttgaggtcgggcaggatgtcacgcgcttttcgatc
tcggatcgcattgctgttgatcccgttattccttgtcgttcctgcctgtattgccgcagt
ggaaaagagaatgtttgccaacatcgtcaggcgataggttacgagtttgatggtgcattc
gctgagtacgtcaaaataccggcgatcgcccttgaggcaggcaatgttttcaaattaccc
gatagcgtttcctatgatgctgccgctctggccgagcctttagcctgctgtattaacggg
cagaaaaacgtgggtatccacctgggtgatgtggtggtgattcttggcgcaggcccaata
ggactgatgcatgtcgcgctggcgaaacggtcaggtgcatcaaaaatcattgttagcgac
ctcaatgaaaacaggcgcagtgttgccctgcaatgcggtgcctcccatgcggttgacgcc
agccaacaggatctgaaagccattgtcatgtctgagacgtctgggctgggggcggatgtg
gcgatcatggctatcggccttcccgcgctggtgaatccgtctctggaattactgcgaaaa
ggcggtcgggccaacctctttgccggtttctcaaaagaggatacggccgatgtggatgtc
aatcttatccactacaacgaactggtcattaccggtgccagtgcgctaagccgggaaggt
tatgaaaaggcacttgggctaatttcatcgggccaaatcaatgtcgaagccttaattact
caccgttttagcttatccgaaataagtgaagcgcttcgctatgcgcaaaagggtgatgct
gtgaaggtcattattcacaacgattaa

DBGET integrated database retrieval system