KEGG   Pantoea ananatis LMG 20103: PANA_1872Help
Entry
PANA_1872         CDS       T01195                                 

Gene name
xylA
Definition
(GenBank) XylA
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00040  Pentose and glucuronate interconversions
pam00051  Fructose and mannose metabolism
pam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA_1872 (xylA)
   00051 Fructose and mannose metabolism
    PANA_1872 (xylA)
Enzymes [BR:pam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PANA_1872 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADD77039
UniProt: D4GED2
LinkDB All DBs
Position
2091958..2092947
Genome map
AA seq 329 aa AA seqDB search
MSLMSDLKFATRLNSFASGAHLYWPDLQGKPSVLQMVARAGKVKGLTHLDLNYPQHLTSD
SKTLRQAIEDAGLAVNGMQMRWDAPQFKIGAFTHPDPKIRREAIDLTKRGIDTGREFGSR
LMTLWMGQDGFDYCFQVDYKKIWEDAVSAVREIADYAPDVDVSIEYKPNEPRAYSIFPNV
TTCLLAVEEAGSPNLGITLDFAHVLFANEIPAWAAAMVARRSRLLGLDLNDGWGKRDDGL
MAASVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAETNIATVTRLLKLCDQL
NDNPALAAAISRQDAVASQQIVNDIMLAR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgagcctcatgtcagatttaaagtttgctactcgtcttaactcctttgcttcgggggca
catctctactggccagatttgcagggcaagccctctgtactgcaaatggtggcgcgcgcg
ggcaaggttaaaggcttaacgcatttggatctcaactatccccagcacctcaccagtgac
agtaaaacgctgcgccaggctattgaggatgccgggctggcggtcaacggcatgcagatg
cggtgggatgcaccgcagttcaaaattggcgcatttacccatccggatccaaaaattcgc
cgtgaggcgattgacctgaccaagcggggaatcgataccggacgggaatttggctcccgc
ttaatgacgttatggatgggtcaggacggtttcgactactgcttccaggtcgattacaaa
aaaatctgggaagacgccgtcagcgcggtacgtgaaatcgccgactacgcgccggacgtg
gatgtgagcattgaatacaaacccaacgagccgcgtgcctacagcatttttcccaacgtg
accacctgcctgctggccgtcgaagaggccggaagcccgaatctcggcatcacgctggat
ttcgcccatgtcctgttcgccaatgaaattcctgcctgggcggcggccatggtggcgcgt
cgttcccggctgctggggctggatttaaacgacggctggggcaaacgtgacgacggactg
atggcggcatcggttaatccgcgcgccacgttggagtttctgtggcagatgcagcgtgat
ggttatcagggcgcctactattttgacaccttcccggatgccagcggactggatccggta
cgtgaagccgaaaccaacattgccaccgtgacgcgattactcaaactttgcgaccagctt
aatgataatccggcgctggcagcggcgatcagccgtcaggatgcggtcgcctcacagcaa
atcgtcaacgacattatgctggcgcgttaa

DBGET integrated database retrieval system