KEGG   Pantoea ananatis LMG 20103: PANA_2528Help
Entry
PANA_2528         CDS       T01195                                 

Gene name
ahpF
Definition
(GenBank) AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pam  Pantoea ananatis LMG 20103
Brite
KEGG Orthology (KO) [BR:pam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PANA_2528 (ahpF)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PANA_2528 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 NAD_binding_8 Thi4 DAO Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ADD77695
UniProt: D4GIG1
LinkDB All DBs
Position
complement(2827617..2829185)
Genome map
AA seq 522 aa AA seqDB search
MLDTNLKTQLKAYLEKLTKPVELIATLDDGAKSTEIRNLLVDIASLSDKVSFREENDRQV
RKPSFLITNPGADQGPRFAGSPLGHEFTSLVLALLQTGGHPSKEAQSLLDQIAALDGDFH
FETYYSLSCHNCPDVVQALNLMAVLNPRISHTAIDGGLFQNEIQERNVMGVPAVYLNGKE
FGQGRMSLAEIVSKVDTNADKRAAEELNKREAYEVLIVGSGPAGAAAAIYSARKGIRTAL
LGERFGGQVLDTVDIENYISVQKTEGAKLAGALRAHVDDYNVDIIDSQSAIKLIPSAVKG
GLHAIETASGAVLKSRSIILATGARWRNMGVPGEEQYRTKGVTYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVEHVTLLEFASEMRADKVLQDKLRSLKNVDVILNAQTTEVKGD
GSKVTGLQYLDRTNQTTHELALSGIFVQIGLLPNTNWLEGAVERNKMGEIMIDAKCETSL
KGVFAAGDCTTVPYKQIIIASGEGSKASLSAFDYLIRTQPAH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataccaatttaaaaacacagctcaaagcctatcttgagaaactcaccaagcct
gtggagttgattgcgacgctggatgatggcgcgaaatcaacggagattcgcaatttgttg
gtcgatatcgcgagcctgtcagacaaggtcagctttcgtgaagagaacgatcgtcaggtg
cgtaagccctcgtttttaattactaacccaggcgctgatcaggggccgcgttttgccggt
tcgccgctgggtcatgaatttacctcactggtactggcactgctacagaccggtgggcat
ccctctaaagaagcgcaaagcctgctcgaccagattgcggcgctggatggggatttccat
ttcgaaacctattattcactgtcgtgccacaactgtccggatgtggtgcaggcattaaac
ctgatggcggtgttaaacccacgtatcagccacaccgccattgacggtggcctgttccag
aatgaaattcaggaacgcaatgtgatgggcgtgcccgctgtctatctgaatggcaaagaa
ttcggtcagggccgcatgagcctggcggagattgtcagcaaagtcgacaccaatgcagat
aagcgtgccgcagaagagctgaacaagcgtgaggcttacgaggttttgatcgtgggcagc
ggtccggcgggcgccgccgcggctatctactccgcacgtaaagggattcgcaccgcgtta
ctgggcgagcgctttggtggacaggtgttggatacagtcgatattgaaaactacatttcc
gtacagaaaacggaaggggccaaactggccggcgccctgcgcgctcacgtggatgactac
aacgttgacatcattgacagccagagcgcgattaaactgattccctcagcggtgaaaggc
ggcctgcacgctattgaaacggcctccggcgcggtgctgaaatcgcgcagtatcattctt
gccaccggtgcgcgctggcgcaacatgggcgtgcctggcgaagagcaataccgcaccaaa
ggcgtgacgtactgcccacactgcgacggcccgctgtttaaaggcaaacgcacggcggtc
attggcggcggtaactccggcgtagaagccgcaatcgatctggcgggcattgttgaacac
gtgacgctgctggagttcgccagtgaaatgcgtgcagataaagtgctgcaggacaaactg
cgcagcctgaaaaacgtggatgtgattctgaatgcgcaaaccacggaagtgaaaggcgat
ggcagtaaggtgacgggcctgcaatatctggatcgcactaaccagactactcatgagctg
gcgctgtcgggcattttcgtgcagatcggtctgctgcctaacaccaactggctggaaggc
gcggttgagcgcaacaagatgggcgaaatcatgatcgatgcgaaatgcgaaaccagcctg
aaaggcgttttcgccgcaggggactgcaccaccgttccttataagcagatcatcatcgcc
agcggtgaaggatcaaaagcctcactgagcgcgtttgattacctgattcgcacccagcct
gcgcactaa

DBGET integrated database retrieval system