KEGG   Pseudomonas amygdali: BKM19_008640Help
Entry
BKM19_008640      CDS       T05354                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pamg  Pseudomonas amygdali
Brite
Enzymes [BR:pamg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BKM19_008640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AVB13664
UniProt: A0A2G4CQZ7
LinkDB All DBs
Position
1645139..1645657
Genome map
AA seq 172 aa AA seqDB search
MKPHLWLGLLGVFSLSVQAASLDVPINLVSADGAPKPVGNVTVSETQYGLLFTPNLKDLP
AGIHGFHVHENGSCDAGTKDGKKVAALAAGGHFDPAKTGKHLGPYADGHLGDLPALYVNA
DGTANYPVLAPRLKKISEIKGHALMVHAGGDNHSDHPAPLGGGGDRAACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcatctttggctaggcctgcttggcgttttctccctcagtgtccaggctgca
tcgctggacgttcccatcaatctggtcagcgctgacggcgcgcccaaacctgttggcaac
gtgacggtgagcgaaacacagtacggcttgctgtttaccccgaatctgaaagacttgcct
gcgggcattcacggttttcacgtacatgaaaatggcagctgcgacgccggtacgaaggac
ggcaagaaggtcgctgcgctggccgcaggcggtcactttgacccggccaaaaccggcaag
catctggggccttacgctgatggccatctaggcgatctgcctgcgttgtacgttaacgcc
gacggcactgcaaactatccggtactggcaccacggttgaagaaaatctccgaaatcaaa
ggccatgcgctgatggttcatgcgggcggcgacaaccattccgaccaccctgcacccttg
ggcggtggcggtgatcgtgcagcctgtggcgtgatctga

DBGET integrated database retrieval system