KEGG   Pseudomonas amygdali: BKM19_011520Help
Entry
BKM19_011520      CDS       T05354                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKM19_011520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pamg02000]
    BKM19_011520
Enzymes [BR:pamg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BKM19_011520
Transporters [BR:pamg02000]
 Other Transporters
  Pores ion channels [TC:1]
   BKM19_011520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AVB14150
UniProt: A0A0N0XGQ7
LinkDB All DBs
Position
2265488..2266090
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYNSGNCYKVKLMLNLLGSEYEWVPVDILNGETQTPAFLEKNPNGKIPVLELED
GTCLWESNAILNFLADGSRYLPSEPRLRTQVLQWQFFEQYSHEPSVAVARFIQFYLGLPA
ERMTEYRAMQKSGYRALAVMEQQLDRTPFLVGENFSIADIALYAYTHVAHQGGFDLAPYT
GIRRWLDRVKAQPGYVGMLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtttatggcgattacaactcgggcaactgctacaaggtcaagttgatgctt
aacctgttgggcagtgagtacgagtgggtgccggtcgatattcttaatggcgaaacccag
accccggcttttctggagaagaacccaaacggcaagatcccggtgttggaactggaagac
ggcacttgtctatgggagtccaatgcgattctcaattttctggctgatggttccaggtat
cttccgagcgaaccgcggctgcgcacccaggttctgcaatggcagtttttcgagcagtac
agccatgagccgtcggtggcggttgcccgcttcatccagttctatctgggcttgccggct
gaacgcatgaccgagtatcgggccatgcagaaatccggttatcgagcgctggcggtcatg
gagcagcagcttgatcgcacaccgtttctggtcggtgagaatttctccatcgccgatatc
gccctgtacgcctatacccatgtcgctcatcagggcggtttcgatctggcaccttacacc
ggaattcggcgctggctggatcgggtcaaggcgcaaccgggttatgtcggtatgctggat
tga

DBGET integrated database retrieval system