KEGG   Pseudomonas amygdali: BKM19_012650Help
Entry
BKM19_012650      CDS       T05354                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00020  Citrate cycle (TCA cycle)
pamg00190  Oxidative phosphorylation
pamg00650  Butanoate metabolism
pamg01100  Metabolic pathways
pamg01110  Biosynthesis of secondary metabolites
pamg01120  Microbial metabolism in diverse environments
pamg01130  Biosynthesis of antibiotics
pamg01200  Carbon metabolism
Module
pamg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pamg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pamg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM19_012650
   00650 Butanoate metabolism
    BKM19_012650
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BKM19_012650
Enzymes [BR:pamg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BKM19_012650
    1.3.5.4  fumarate reductase (quinol)
     BKM19_012650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO HI0933_like FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AVB14345
UniProt: A0A0N0XNE4
LinkDB All DBs
Position
2510152..2511924
Genome map
AA seq 590 aa AA seqDB search
MANINSLSFDAIIIGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQANLKAGTVFLNEYYGVDLVKNQDGAF
VGIIAICIETGETSYIRANATVLATGGAGRIYSSTTNALINTGDGIGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGCGPDGDHVMLKLDHLGEEVLHSRLPGIMELSKTFAHVDPATAPIPVVPTCHYMMG
GVATNIHGQAITQDAAGVDQIIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGIH
LEKALSEGIDYARASESDIDAALARVAGLNERTTGEDVATLRKELQSCMQNYFGVFRTGE
YMQKGIAQLADLRVRIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEHRKESRG
AHAREDFEDRDDENWLCHTLYFPGDKRVTKRAVNFSPKTVPTFEPKIRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctaacataaattcgctttccttcgacgccatcatcattggtggtggcggtgccggt
atgcgcgctgccctgcagctcgctcagggcggtcacaagactgccgtggtcaccaaggtg
tttccgacacgctcgcacaccgtttctgcccagggtggcatcacctgcgcaattgcctct
gccgatccgaacgatgactggcgctggcacatgtacgataccgtcaagggttccgactac
atcggtgaccaggacgctatcgaatacatgtgttccgtaggccctgaagctgttttcgaa
ctcgagcacatgggcttgccgttctcccgtaccgaacagggtcgcatctaccagcgtccg
tttggcggtcagtccaaggacttcggcaagggcggtcaggctgcacgtacctgtgctgct
gccgaccgtaccggtcacgcactgctgcacaccctgtatcaggccaacctcaaggctggc
accgtattcctcaacgaatactacggcgtggatctggtcaagaatcaggacggtgccttt
gtcggcatcatcgccatctgcattgaaaccggcgaaacttcctacatccgtgccaacgct
accgtgctggcaaccggcggtgcaggtcgtatctactcttcgaccaccaacgccctgatc
aataccggtgacggtatcggtatggcactgcgcgccggtgtcccggttcaggacatcgaa
atgtggcagtttcacccgaccggcattgccggtgcaggtgtactggtcaccgaaggctgc
cgcggtgaaggcggttacctgatcaacaagcacggcgagcgtttcatggagcgttatgct
ccgaacgccaaggaccttgcaggtcgtgacgtggttgcgcgctccatggtcaaggaaatc
attgccggtaacggctgtggtccggatggcgaccatgtgatgctcaagctcgatcacctg
ggcgaagaagtgttgcacagccgtttgccaggcattatggagttgtccaagaccttcgct
cacgtcgaccctgcaacagcgccgattccggtagttcctacctgccattacatgatgggc
ggcgttgccaccaacattcatggtcaggcgatcactcaggacgccgccggtgtcgatcag
atcattccgggtctgttcgcggtaggtgaagtggcttgcgtatcggttcacggtgccaac
cgcctgggcggcaactcgttgctcgatctggtggtgttcggtcgcgctgcgggtatccac
ctggagaaagcgctgagcgaaggtatcgactacgcccgtgcttccgagtccgacatcgat
gctgcgctggcacgcgttgccggcctgaacgagcgcactaccggcgaagacgtcgccacg
ctgcgtaaagagctgcaaagctgcatgcagaactacttcggtgtgttccgcaccggcgaa
tacatgcagaagggtattgctcagttggctgacctgcgcgtgcgtatcgccaacgtcaag
atcaatgacaagagccaggcattcaataccgcccgtatcgaagcgcttgaactgcaaaac
ctgctggaagttgccgaagccacggcgatcgccgcagagcatcgtaaagagtcccgcggc
gctcacgcccgtgaagactttgaagatcgcgatgacgagaactggttgtgccacaccctg
tatttcccgggtgacaagcgcgtgaccaagcgtgccgtgaacttctcgccgaagactgtt
ccgacttttgaacctaagattcggacttattaa

DBGET integrated database retrieval system