KEGG   Pseudomonas amygdali: BKM19_012655Help
Entry
BKM19_012655      CDS       T05354                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00020  Citrate cycle (TCA cycle)
pamg00190  Oxidative phosphorylation
pamg00650  Butanoate metabolism
pamg01100  Metabolic pathways
pamg01110  Biosynthesis of secondary metabolites
pamg01120  Microbial metabolism in diverse environments
pamg01130  Biosynthesis of antibiotics
pamg01200  Carbon metabolism
Module
pamg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pamg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pamg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM19_012655 (sdhB)
   00650 Butanoate metabolism
    BKM19_012655 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BKM19_012655 (sdhB)
Enzymes [BR:pamg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BKM19_012655 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BKM19_012655 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AVB14346
UniProt: A0A0N0GTB2
LinkDB All DBs
Position
2511937..2512641
Genome map
AA seq 234 aa AA seqDB search
MLQVSVYRYNPEQDAAPFMQEFQVDTGGKDLMVLDVLALVKEQDQGFSYRRSCREGVCGS
DGMNINGKNGLACITPLSAVVAKNRLIVRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQN
DTPAPAIERLQTPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTRTNERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRNMLLQSGV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagtcagtgtttatcgttacaaccctgagcaggacgccgcgccgttcatgcag
gagtttcaggtcgataccggtggcaaggacctgatggtgctggacgtgctcgccctggtc
aaagaacaggatcaaggcttctcttaccgtcgttcgtgccgcgaaggtgtgtgcggttcc
gatggcatgaacatcaatggcaagaacggtctggcctgcatcacgccgctgtctgccgtt
gtcgccaagaacaggctgatcgtacgtccgctgcctggtttgccggtcattcgtgacctg
gtcgtcgatatgagcatcttctacaagcagtacgagaaggtgaagccgttcctgcagaat
gacacgccggctccggccatcgaacgtctgcaaactccggaagagcgcgaaaagctcgat
ggtctgtacgagtgcattctgtgcgcttgctgctcgacttcctgcccgtccttctggtgg
aatcccgacaagttcctgggtcctgctgcgctgctgcaagcctaccgtttcctggctgac
agccgtgacacccgcaccaatgaacgtctggcttcgcttgatgatccgttcagcgtgttc
cgctgccgcggcatcatgaactgcgtcaacgtgtgcccgaaaggccttaacccaaccaag
gctatcggtcacgtgcgcaacatgttgttgcaaagcggcgtctga

DBGET integrated database retrieval system