KEGG   Pseudomonas amygdali: BKM19_012665Help
Entry
BKM19_012665      CDS       T05354                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00020  Citrate cycle (TCA cycle)
pamg00310  Lysine degradation
pamg00380  Tryptophan metabolism
pamg01100  Metabolic pathways
pamg01110  Biosynthesis of secondary metabolites
pamg01120  Microbial metabolism in diverse environments
pamg01130  Biosynthesis of antibiotics
pamg01200  Carbon metabolism
Module
pamg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pamg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM19_012665
  09105 Amino acid metabolism
   00310 Lysine degradation
    BKM19_012665
   00380 Tryptophan metabolism
    BKM19_012665
Enzymes [BR:pamg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BKM19_012665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AVB14348
UniProt: A0A2S4IZE9
LinkDB All DBs
Position
2515774..2517009
Genome map
AA seq 411 aa AA seqDB search
MAIEIKAPSFPESVADGTISKWYKKEGDAVKRDEMLVDIETDKVVLEVLAEADGVMGSIT
KEEGAIVLSNEVLGTLNDCATASAAPALAAAPASAAPASAPAAAPAAAGEEDPIAAPAAR
QLAEENGINLASVKGTGKDGRITKEDVVAAVEAKKSAPAAAPAAKPAAAAAPVVAAGDRT
EKRVPMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGF
MSFFVKAATEALKRFPAVNASIDGSDIVYHGYADVGVAVSSDRGLVVPVLRNAEHMSLAE
IEGGIATFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQR
PMAVNGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccctctttcccggaatccgttgccgatggcaccatttcc
aagtggtacaaaaaagagggtgatgcggtaaaacgggacgagatgctggtcgatatcgag
actgacaaggttgttctggaagtattggccgaagctgacggcgtgatgggctcgatcacc
aaggaagagggcgctatcgtcctctccaacgaagtgcttggcactttgaatgattgtgcc
acggcatctgctgctccagcacttgctgctgcccctgcctctgctgcgcctgcctcggca
cccgccgctgcaccggctgccgctggcgaagaagacccgattgccgcgcctgctgcgcgt
caactcgctgaagaaaacggtattaacctggccagcgtcaaaggcactggtaaagacggc
cgtatcaccaaggaagacgtggtcgctgccgttgaggcgaagaaatccgctccagccgcc
gctcctgctgccaaacctgctgccgctgccgctccggttgtcgctgctggcgaccgcacc
gagaagcgcgtgccgatgactcgtgtacgtgcaaccgttgccaagcgtctggtcgaagcc
cagtcgaacatggccatgctgaccacgttcaacgaagtcgacatgaccgaagtcatggca
ctgcgttcgaagtacaaggacctgttcgagaagtcgcacaacggcgtgcgtctgggcttc
atgtcgttcttcgtcaaggctgctaccgaggcgctgaaacgcttcccggctgtcaacgcg
tcgatcgacggctccgacatcgtctaccacggctacgctgacgtcggtgttgcagtgtcc
agcgaccgtggtctggttgtaccggttctgcgtaacgccgagcacatgagcctggctgaa
attgaaggcggcatcgccaccttcggcaagaaggcccgtgatggcaaactgtccatcgac
gagatgaccggtggcaccttcacgatcactaatggtggtactttcggttcgatgatgtcg
acgccgatcgtcaacccgccacaggctgcaattctgggcatgcacaacattcttcagcgc
ccgatggcagtcaacggtcaggtagtgattcgtccgatgatgtatctggcactgtcgtac
gatcaccgtttgattgacggcaaggaagcggtaaccttcctcgtgaccatcaagaacctg
ctggaagatccggctcgtctgttgctggatatctga

DBGET integrated database retrieval system