KEGG   Pseudomonas amygdali: BKM19_012790Help
Entry
BKM19_012790      CDS       T05354                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
pamg  Pseudomonas amygdali
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pamg02022]
    BKM19_012790
Two-component system [BR:pamg02022]
 OmpR family
  Unclassified
   BKM19_012790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF5100
Motif
Other DBs
NCBI-ProteinID: AVB17410
UniProt: A0A2G4DHT2
LinkDB All DBs
Position
complement(2539954..2540703)
Genome map
AA seq 249 aa AA seqDB search
MQALPDTPLDATSTDQRWSVRALIVDDDVAIRELLCDYLTRFNINARGVTDGTQMRQALT
EETFDVVVLDLMLPGEDGLSLCRWLRSTSDIPILMLTARCEPTDRIIGLELGADDYMAKP
FEPRELVARIQTILRRVRDERSDQRTTIRFDAWRLNSVLRQLTAADGLVVPLSNAEFRLL
RVFLERPHRVLSREQLLDAARGRSIEAFDRSIDLLVSRLRQKLGDDPKNPQLIKTVRGEG
YLFDARELG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcacttcccgacacccccctggatgccacatcgaccgatcagcgctggagcgtt
cgcgcgctgattgtcgatgacgatgtggccattcgcgaactgctctgcgattacctgacg
cgcttcaatatcaacgctcgtggcgtcaccgacggcacgcagatgcgtcaggcattgacc
gaggaaaccttcgacgtggtggtgctcgacctgatgctgcccggtgaagacggcctgtcg
ctgtgccgctggctgcgcagcacctcggacatcccgattctgatgctgaccgcacgctgc
gaacccactgaccggatcatcggtctggaactgggtgccgacgattacatggccaagccg
ttcgagccgcgcgagctggtcgcgcgtatccagaccattctgcgccgggtccgcgacgaa
cgcagcgatcagcgcaccaccattcgctttgacgcctggcggctgaacagcgtgctgcgt
caattgacagccgccgacggtctggtggtgccgctgtccaacgccgagttccgtctgctg
cgcgtatttctcgaacggccgcaccgggtgctgagccgtgaacagttgctggacgccgcc
cggggccgatcaatagaggcgttcgaccgcagcatcgatttgctggtctcgcgtttacgt
cagaagctcggcgacgacccgaagaacccgcagttgatcaagactgtgcgcggtgaaggc
tatttgttcgatgccagggagctgggttga

DBGET integrated database retrieval system