KEGG   Pseudomonas amygdali: BKM19_015475Help
Entry
BKM19_015475      CDS       T05354                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00500  Starch and sucrose metabolism
pamg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKM19_015475 (treS)
Enzymes [BR:pamg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BKM19_015475 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BKM19_015475 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AVB14830
UniProt: A0A2P4GJ06
LinkDB All DBs
Position
3128333..3131659
Genome map
AA seq 1108 aa AA seqDB search
MAKKPGDATFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFAGLIEKLDYIAALGVNTIW
LLPFYPSPRRDDGYDISEYRDVHSDYGTMADAKRFIAQAHKRGLRVISELVINHTSDQHP
WFQKARHAKPGSKARDFYVWSDTDQKYDGTRIIFLDTETSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPHVLDAVLEVMRFWLDLGIDGLRLDAIPYLIERDGTNNENLPETHQVLKRIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDSKGPDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPENCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLVDRDRRRVELLNSMLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPMYGFQSVNVEIQERDPHSLLNWNRRMLAVRKQQKAFGRGTLKM
LSPSNRRILAYTREYTAPDGHSEVVLCVANVSSAAQAAELELSAHAGTVPVEMLGGSAFP
PIGQLSYLLTLPPYGFYWFLLASENQMPSWHVEPAQSMPDFPTLVLKKRLEELLEEPLRS
TMEKTSLAVYLPKRRWFAGKGKDIEQVNIAYAVRFGDEAHPVLLSEIEVTADGQTDRYQL
PFGLLAEDDISSALPQQLALARVRRNRDVGLITDAFTLETFIRAVIQGMQSDTVIPCADG
ELRFEQSSQLAPLALTAESEVRYLSAEQSNSSVVVGGSVVLKLIRKVSAGTHPELEMGAF
LTNAGFKNISPLLGSVVRVGNDGKPNLLMIAQGYLSNQGDAWEWTQNNLERAVRDELAHG
VSGQEQHYNALLELADFSRSLGQRLGEMHQILASPTDNADFAVEVTSSQDSKASGTSVNA
QLERALQLLEQRKGDLEQDDQQLVSDLLAQRKQIRQRVEGLAKRSAGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARALEERRAKHSPFKDVSGVLRSFDYAAAMAVRSAQSVDTSP
EAAGARKRVAETYLAQAREAFIEGYRSATSGMAHAWKDAKGEDAALELFTLEKAAYEVIY
EAENRPAWLAVPLQGLRGLLQPSDGEPI
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagcccggtgacgcgacattcatcaaagacccgctctggtacaaggatgcg
gtgatttaccaggttcatgtgaaatcgttcttcgattccaataacgacgggatcggcgat
ttcgcgggcttgatcgaaaagctcgactacattgccgcgctgggcgtcaacaccatctgg
ttgctgccgttctacccgtcgccgcgccgggacgatggctacgatatttccgaataccgc
gatgtgcatagcgattacggcaccatggccgatgccaagcgcttcattgcccaggcgcac
aagcgtggcctgcgggtgatcagtgagctggttatcaaccatacgtccgaccagcacccg
tggtttcagaaagcgcgtcatgccaagcccggctccaaggcacgggatttctatgtctgg
tcggacaccgaccagaagtacgacggcacgcggatcatttttctcgacacagaaacgtcc
aactggacctgggacccggtcgccgggcaatacttctggcaccgtttttactcccaccaa
ccagacctgaacttcgataacccgcacgtacttgatgcggtgcttgaagtcatgcgcttc
tggctggacctgggcattgacggtttgcgtctggacgctatcccatacctgatcgaacgc
gatggcaccaataacgagaaccttccggaaacccatcaggtgctcaagcgtattcgcgcc
gagatcgatgcgaactacccggaccgcatgctgctggccgaggccaatcaatggccggaa
gacacccagctgtatttcggcgacagcaaggggccggatggcgacgaatgtcacatggcg
tttcacttcccgctgatgccgcgcatgtacatggcgctggcgcaggaagaccgctttccg
atcaccgatattctgcgccagacaccggaaattccggagaattgccagtgggcgattttc
ctccgcaaccacgacgaactgaccttggaaatggtgacggatcgtgagcgtgattacctc
tggaattactatgccgctgaccgccgcgcgcggatcaacctgggtattcgtcgacgcctg
gcaccactggttgatcgggaccgccgccgggtcgaactgttgaacagcatgctgttgtcg
atgcccggcacgccgacgttgtattacggtgatgagatcggcatgggcgacaacatctat
ctaggcgaccgggatggtgtgcgtacgccgatgcagtggtcgatcgaccgcaacggcggc
ttttcgcgtgcagatccggccagcctggtattgccgccgatcatggacccgatgtacggc
tttcagtcggtcaacgtcgaaattcaggagcgtgacccgcactcgctgctgaactggaat
cgacgcatgctggcggtgcgcaaacagcagaaggcattcgggcgtggcacgctgaaaatg
ctctcgccgtcgaaccgccgcattcttgcgtatacccgcgagtacacggcacccgatggt
cacagcgaagtggtgttgtgtgttgccaacgtttccagcgccgctcaggctgcagagctt
gagctgtcggctcacgcaggcacagtgccggtggaaatgctcggtggcagcgcatttccg
cctatcgggcagttaagctatttgctgacgctcccgccgtatggtttttactggttttta
ctggcttcggagaatcaaatgcccagttggcacgttgaacccgcgcagagcatgccggac
ttcccgaccctggtgctcaagaagcgccttgaggagttgctcgaagagccgctgcgcagc
accatggaaaaaacgtcactggctgtttatttgccaaaacgccgctggttcgcaggcaag
ggcaaggacatagagcaggtcaatatcgcgtatgcggtgcgtttcggcgatgaggcgcac
cctgtgttgctcagcgaaatagaagtgactgcagacggccagaccgatcgctatcagctg
ccattcggcttgctcgccgaagacgacatcagcagcgcgttgccacagcaactggcactt
gccagagtgcggcgtaatcgtgatgtagggctgatcaccgatgcgtttactctggaaacc
ttcattcgtgcagtgattcagggcatgcagtcggatacggtcatcccctgcgctgacggc
gagttgcgtttcgagcaaagttcgcagctggcaccgctcgccctcaccgcagagtcggaa
gtgcgctacctgtctgccgagcagtcgaacagctcggtggtcgtcggtggcagcgtggtg
ctcaaactgattcgtaaagtcagtgccgggacgcacccggagctggaaatgggtgctttc
ctgaccaacgctggcttcaagaatatctcgccgttgcttggctctgtggtgcgtgtcggc
aacgacggaaaaccgaatctgctgatgattgcccaaggctacctgagcaatcagggtgac
gcttgggagtggacacagaacaatctggaacgcgcagtacgcgatgagttggcgcatggc
gtttccggccaggaacagcattacaatgcgttgctggagctggcggacttttcgcgtagc
cttggtcagcgtctcggtgaaatgcaccagattctggcgtcgcctaccgacaatgcagac
ttcgctgttgaagtcaccagcagtcaggacagcaaggcctccggaaccagcgtcaatgct
cagcttgagcgcgccttgcaactgcttgagcagcgcaagggcgatctggaacaggacgat
cagcaactggtcagcgatttgcttgcacagcgcaagcagattcgtcagcgcgtcgaaggt
ctggccaagcgctcggcaggtggcctgcggattcgcgtgcatggtgacttgcacctcggg
caagtgctggtggtcaaaggcgatgcctacctgatcgatttcgagggtgaaccggcccgc
gcacttgaagaacgccgtgccaagcacagcccgttcaaggatgtcagcggtgttttgcgc
tcgtttgactacgctgccgccatggcagtacgcagcgcacaaagcgtcgatacctcgcct
gaggctgccggtgctcgcaaacgtgtcgccgagacctacctggcgcaggcgcgggaagcc
tttatcgaaggttatcgctcggcaacgagcggaatggctcatgcctggaaagatgcaaaa
ggggaggacgccgcactggaattgttcacccttgaaaaagctgcttatgaagtgatctac
gaagccgagaatcgtccagcctggttggccgttcccttgcaaggcttgcgtgggttgctg
caaccgtctgatggagagccaatatga

DBGET integrated database retrieval system