KEGG   Pseudomonas amygdali: BKM19_015855Help
Entry
BKM19_015855      CDS       T05354                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pamg  Pseudomonas amygdali
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM19_015855
Enzymes [BR:pamg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BKM19_015855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AVB14897
UniProt: A0A2G4CWB8
LinkDB All DBs
Position
complement(3213633..3214748)
Genome map
AA seq 371 aa AA seqDB search
MSTVIERTAGQLSPVIPSTMQAVVCYGPEDYRLETVDVPTPGPDEILTKVELCGICMGDI
KTYRGAPSFWGDAEQPRYVKPPMIPGHEFVCRVVALGPGAEKRGVQIGDRVISEQIVPCW
GCRFCNHGQYWMCQKHDLYGFQNNVQGAMAQYMIFTKEGIIHKVPDSIAPDEAILIEPLA
CSLHAAERANVDFDDIVVVAGAGTLGLGIIGAVRMRNPKKLIVLDMKPERAALALRMGAD
EVWNPAEVDVLAKIREITGGYGCDIYIEATGHHKAVNQGLAMLRKLGRFVEFSVFNDEAT
VDWSIIGDRKELDVLGSHLGPYMYPRAIDFIGNRKIDMRDVVTHKFPLAEFKEAFAVMER
GDKSLKVVLQP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcattgaacgcactgccggacaactctctcccgtgattccgtccaccatg
caagcggtggtttgctatggcccggaagactaccggctggagaccgtcgatgtgccgacg
ccaggccccgacgaaatcctcaccaaggtagagctgtgcgggatttgcatgggcgacatc
aagacctaccgcggcgctccgtcattctggggcgatgccgagcagccccgttacgtcaaa
ccaccgatgattccgggccatgaatttgtctgccgggtggtcgcgctcggcccaggcgca
gaaaagcgtggcgtgcagatcggcgaccgggtgatttccgagcagatcgtcccgtgctgg
ggctgccgcttctgcaaccacgggcaatactggatgtgtcagaaacacgacctgtacggt
tttcagaacaacgtgcagggcgcgatggcccagtacatgatcttcaccaaagaaggcatc
atccataaagtgccggattcgattgccccggacgaagcgatcctgatcgaaccactggcc
tgctcgttgcacgcggcagaacgagccaatgtcgatttcgacgacatcgtggtggtcgcc
ggtgcgggcacgctgggccttggaatcattggcgcagtgcgtatgcgcaatccgaaaaaa
ctcatcgtgctggacatgaaacccgagcgcgccgccctcgccttgcgcatgggcgctgac
gaggtgtggaacccggccgaggtcgacgtgctggcgaagatccgtgagataaccggcggc
tacggctgcgacatctatatagaagccacagggcatcacaaggcggtcaatcagggcctg
gcgatgctgcgcaaacttgggcgctttgtggagttcagcgtgttcaacgacgaggccacg
gtggactggtcgatcattggcgaccgcaaggaactggacgtactcggctcccatctgggg
ccttacatgtacccgcgcgccatcgacttcattggcaaccgcaagatcgacatgcgcgat
gtcgtcacgcacaaattccccctggcggagttcaaggaggcgttcgcggtcatggagcgt
ggcgacaaatcattgaaggtcgttctgcaaccttga

DBGET integrated database retrieval system