KEGG   Pseudomonas amygdali: BKM19_017495Help
Entry
BKM19_017495      CDS       T05354                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pamg  Pseudomonas amygdali
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM19_017495
Enzymes [BR:pamg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BKM19_017495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C Thi4 Glutaredoxin K_oxygenase FAD_binding_3 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AVB15166
UniProt: A0A0N0XNZ2
LinkDB All DBs
Position
complement(3545571..3547133)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGTDAR
TPSFSLSSPGHDISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRALQGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPGIKHVAIDGALFQDEVTDRKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKQAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADKLIPGAAGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDEQ
KVNGLRYKNRTTGEEITVPLEGIFVQIGLLPNSEWLKGSIELSPRGEIVVDARGETSVPG
IFAAGDVTVTPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctatctggagcgggttactcgcccc
atcgagatcgtcgcgtcccttgatgacggcgcgaagtctcaggaaatgcttgcactgctc
aatgatgtgatcagtgtctccaaagatgtcaccctgaatgacagcggcaccgacgcacgt
acgccgtcgttctcgctgagcagccctggccacgatatcagcctgcgtttcgccggtatc
cccatgggccacgaattcacctcgctggtcctggcgctgctgcaagttggcggttaccca
cccaaggtcagtgcggaaaccatcgaacaggttcgcgctcttcaaggcgaattccatttc
gaaacctatttctcgcagtcctgccagaactgcccggacgttgtccaggcattgaacctg
atggcagtactgaaccctggcatcaagcatgtcgctatcgacggtgcactgttccaggac
gaagtgactgatcgcaagatcatgtcggtgcccagcatctatctgaatggcgagctgttc
ggtcagggccgcatgggcctggaagaaattctcgccaagatcgacaccggtgccggtgcg
cgtcaggcagaaaaactcaacgccaaacaggcttttgatgtgctggtagtcggcggcggc
cctgctggttcggcggctgcggtctacgcagcccgcaaaggcattcgtaccggcgttgca
gccgaacgtttcggcggtcaggtgctcgacaccatggccatcgaaaacttcatttcggta
cagcacaccgagggcccaaaactggccgttgcgctggaagagcacgtcaagcagtacgaa
gtcgacatcatgaacctgcaacgcgccgacaagctgattccgggcgcggccggtgagctg
cacgaagttaaattcgccagcggtgccagcctcaaggccaagaccgtcattcttgccacc
ggtgcacgctggagggagatgaacgtaccgggcgaacagcagtaccgtaacaagggcgtg
gcttattgcccgcactgcgacggtccattgttcaagggcaagcgcgttgccgtgattggt
ggcggtaactcgggtgtcgaggcggcaatcgatctggcgggtatcgtgtcacacgtgacg
ctgctggaattcgatgtgcaactgcgtgccgatgccgtcttgcagcgcaaactgcacagc
ctgcccaacgttaccgtgatcaccagtgcgcaaaccactgaggtgaccggcgatgagcag
aaggtcaacggcctgcgttacaagaaccgcaccaccggcgaagaaatcaccgtgccgctg
gaaggtatcttcgtgcagatcggcctgctgcctaacagcgaatggctcaaaggctccatc
gagctgtcgccgcgtggtgagatcgtggtcgatgcacgtggtgaaacctcggtgccgggc
atcttcgctgccggtgacgtgacggtaactccgtacaagcagatcatcatcgccctgggc
gagggtgccaaagcctccctgagtgcctttgaccacctgatccgtacctccgcaccggcc
tga

DBGET integrated database retrieval system