KEGG   Pseudomonas amygdali: BKM19_019020Help
Entry
BKM19_019020      CDS       T05354                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pamg00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BKM19_019020 (ligD)
Enzymes [BR:pamg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BKM19_019020 (ligD)
DNA repair and recombination proteins [BR:pamg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BKM19_019020 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AVB15421
UniProt: A0A2G4CZT2
LinkDB All DBs
Position
complement(3890674..3893274)
Genome map
AA seq 866 aa AA seqDB search
MAKPASEYTRKRNFAITSEPAESTRKGKSSSKAKALGFVIQKHDARNLHYDFRLELDGTL
KSWAVPKGPSLDPKQKRLAVHVEDHPLDYADFEGSIPKGQYGGGDVIVWDRGVWQPHGDP
QKTYEEGKLKFTLVGEKLSGDWALVRTRLTGSGSKEQWLLIKEKDAIARPAAEYDITLEQ
PQSVISGAHLGAGRAAPAKPKASAANEKAKAGAAKPAHKPAQKKSKTVFPETLSPQLATL
VDAPPAGDWLYEIKFDGYRILTRIQGDEVRLFTRNGHDWTERLPELVKALKGLKLQNSWF
DGEVVVLDEQGLPDFQGLQNAFDAGNSKNILYYLFDMPFLSAEDLREVPLEQRRDALKQV
LDAQRSRLLRYSDAFQAGHQDIVESAAAMGLEGVIGKRAGSVYIGKRNADWIKLKCRLRQ
ELVIVGYTAPQGSRSAFGALLLAVNEGDEGLVYAGRVGTGFSEVTLEQLYQQLKPLQRKD
SPLAKKLTSAQARGVQWVEPQLVCEAEFAQWTREGIVRQAAFVGLRSDKPASEVVREDAQ
PARVASQTRTQSTSAAPRSGKKTAAGKGKVDVAGTGISHPDRVIDSKTGTSKVELAQFYA
SIAEWILPYLNKRPVALLRCPEGIDGEQFFQKHAEHLAIPHIKQLDRALDPGHAALMEID
SLQALVGAAQMGAIELHTWGATRDRIETPDHFVLDLDPDPALPWRSMIEATQMVLAVLEE
LGLEAFLKTSGGKGMHIIVPLARQADWDTVKAFAKAIAEFVSRQLPERFTATMGPKNRVG
KIFIDYLRNSRGGSTVTAYSVRARPGLPVSVPIALDELAGLKSSAQWDITNLEQRLKKLK
ADPWAGYSNRRKITQKMWKQLGAKRP
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccgccagtgaatacacgcgcaagcgcaatttcgccatcacctccgagcct
gccgaaagcacgcgcaaaggcaagtcttcgtccaaggccaaggcgctgggtttcgtgatt
cagaagcatgacgcacgcaacctgcactacgactttcgactggagctggatggcacgctc
aagagctgggcggtgcccaaaggcccgagcctggaccccaagcaaaaacgtctggcggtg
catgttgaagaccacccgctggactatgccgattttgagggcagcatcccgaaagggcag
tacggcggcggtgatgtgattgtctgggaccgtggcgtctggcagccgcacggtgatccg
caaaaaacctatgaggaaggcaaactcaaatttaccctggtcggcgagaagctcagcggc
gactgggcgctggtgcgcacgcggctcacgggcagcggcagcaaggagcagtggctgctg
atcaaagaaaaggacgccattgcgcgacctgccgccgaatatgacatcactctggagcag
ccgcagagcgtgatcagcggcgcgcacctaggggcagggcgtgcagcgccagcgaagcca
aaagccagcgccgcaaacgaaaaagccaaagccggtgcagcgaagcctgcgcacaagccc
gcgcaaaagaagtcgaaaacggttttcccggaaaccctttcgccgcaactggccacgttg
gtagatgcaccgccagcgggtgactggctgtatgagatcaagttcgatggctatcgcatt
ctgacccgcattcagggcgacgaagtgcgcctgttcacccgtaacggccacgactggacc
gaacggctgcccgagctggtcaaggcgctcaagggcctgaaattgcaaaacagttggttc
gacggcgaagtagtggttctcgacgagcaagggttgcccgactttcaggggttgcagaat
gcctttgacgcagggaacagcaaaaacatcctgtattacctgttcgatatgccgttcctg
agtgcggaggatctgcgtgaagtaccccttgagcagcgccgcgacgccttgaagcaagtg
ctcgacgcccagcgcagtcgcttgctgcgttattcggatgcgtttcaggccgggcatcag
gatattgtggaaagcgctgcggcaatgggcctggaaggtgtcatcggcaagcgggccggc
agtgtttatatcggcaagcgcaacgccgactggatcaaactcaaatgccggttgcgtcag
gaactggtgatcgtcggctacaccgccccgcaaggcagccgctcggccttcggagccttg
ttgctggcggtcaatgagggcgatgaaggactggtctatgccgggcgggtgggcaccggc
ttcagtgaggtgacgcttgaacagctttatcaacaactcaaaccgctgcagcgcaaggat
tcacctctggcgaaaaagctgacctcggctcaggcccgtggcgtgcagtgggtagagccg
caactggtctgtgaggcggagttcgcccagtggacccgcgaaggcattgtgcgacaagcc
gcatttgtcgggttgcgcagtgacaagcctgccagtgaggtggtgcgcgaagacgctcag
cccgccagggttgccagccagacccggacgcaatcgacatcggcagcgccgcgttcaggc
aagaaaaccgctgccggcaaaggcaaagtagacgttgcgggcaccggcatcagccatccg
gatcgggtgatcgacagcaagaccggcaccagcaaggtcgaacttgcgcagttctacgcg
tctattgccgaatggattctgccgtatctgaacaagcgtcctgtggcattgttgcgttgc
ccggaaggcatcgacggcgagcagttcttccagaagcacgccgagcatcttgcgattcca
cacatcaaacagctggatcgtgctctggaccccgggcatgccgcgctgatggagatcgat
tcattgcaggcgctggtcggtgccgcgcaaatgggggccatcgagttgcacacctggggc
gctacgcgtgacaggatcgaaacgccggatcattttgtactggaccttgatcccgacccg
gcgctgccctggcgcagcatgatcgaagccacgcaaatggtgctcgccgtgctggaggag
cttgggctggaggcttttctcaagaccagcggcggcaagggcatgcacatcatcgtgccg
ttggcgcggcaggctgactgggacacggttaaagccttcgccaaggctatcgccgaattc
gtcagccgtcagttgcccgaacgcttcaccgcgaccatggggccgaaaaaccgggtaggg
aaaattttcattgattacctgcgcaacagccgtggcggcagcaccgtgactgcgtattcg
gtgcgcgcccggccaggtttgccggtctcggtgccgattgctctggatgaactggcaggc
ctgaaatcctcggcgcagtgggacatcaccaaccttgagcagcgtttaaagaaactcaag
gccgacccgtgggcaggctacagcaaccgccgcaaaatcacgcagaagatgtggaagcag
ttgggggcgaaacgtccctga

DBGET integrated database retrieval system