KEGG   Pseudomonas amygdali: BKM19_024165Help
Entry
BKM19_024165      CDS       T05354                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pamg  Pseudomonas amygdali
Pathway
pamg00473  D-Alanine metabolism
pamg00550  Peptidoglycan biosynthesis
pamg01100  Metabolic pathways
pamg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BKM19_024165
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKM19_024165
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BKM19_024165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pamg01011]
    BKM19_024165
Enzymes [BR:pamg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BKM19_024165
Peptidoglycan biosynthesis and degradation proteins [BR:pamg01011]
 Precursor biosynthesis
  Amino acid ligase
   BKM19_024165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 TTL ATPgrasp_YheCD ATPgrasp_Ter ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AVB16303
UniProt: A0A2G4DAX9
LinkDB All DBs
Position
complement(4959852..4960811)
Genome map
AA seq 319 aa AA seqDB search
MTAVAQPSLRSTLEPKSFGRVAVLFGGKSAERAVSLNSGNAVLKALLDAGVDAFGIDVGD
DFLQRLVSENIDRAFIVLHGRGGEDGTMQGMLECLEIPYTGSGVLASALAMDKLRTKQVW
QSLGLATPLHAVLGNESDCICAATELGFPLIVKPAHEGSSIGMAKVNSVDELIAAWKAAS
TYDSQVLVEQWIQGPEFTVASLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLGD
AQEQELKQLAARACDAIGIAGWARTDVMQDAQGKFWLLEVNTVPGMTDHSLVPMAARAAG
LDFQQLVLAILADSVQARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgtcgcccagccgtccctgcgctcgacactcgagccgaaaagcttcggccgt
gtcgccgtgctctttggtggcaagagtgccgagcgtgcagtctccctgaactcgggtaat
gccgtgctcaaggcactgctcgatgctggcgtggatgcgttcggcattgatgtgggcgat
gacttcctgcagcgactggtcagtgaaaatatcgaccgtgccttcattgttctgcacggg
cgaggcggcgaagacggcaccatgcaaggcatgttggaatgcctggaaatcccttatacc
ggcagtggtgtactggcttccgcgctggcgatggacaagttgcgcaccaagcaggtctgg
cagagtctcggccttgcaacgcccttgcatgctgttcttggaaacgagagcgattgtatt
tgcgcagcgacggaactgggcttccctttgatcgtcaaaccggcccatgaaggttcaagt
atcggtatggcaaaggtgaacagcgtcgatgaattgatcgccgcctggaaagccgccagt
acctacgattcgcaagtattagtcgaacagtggattcagggacctgagttcactgtggcg
tctctgcgtggccaggtgttgcctcccattggcctgggcactcctcacagtttttatgat
tacgatgccaagtacctggcgtccgatactcagtaccggatcccttgcgggcttggcgat
gcgcaggaacaggaactcaaacaacttgcagcacgcgcttgcgacgccatcggtattgca
gggtgggcgcgcacggatgtcatgcaggacgcacaaggcaagttctggttactggaagtg
aataccgtgcccggcatgaccgatcacagtctggtgccaatggctgcgcgtgctgcaggt
ctggattttcaacaactggtgttggcgattctggccgacagtgttcaggcgagagggtaa

DBGET integrated database retrieval system