KEGG   Pseudomonas amygdali: BKM19_030370
Entry
BKM19_030370      CDS       T05354                                 

Definition
(GenBank) preprotein translocase subunit Tim44
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
pamg  Pseudomonas amygdali
Brite
KEGG Orthology (KO) [BR:pamg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM19_030370
Enzymes [BR:pamg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     BKM19_030370
SSDB
Motif
Pfam: AMP-binding Aconitase_C
Other DBs
NCBI-ProteinID: AVB17669
UniProt: A0A2S4IIA8
LinkDB
Position
p2_tig3:complement(78640..79827)
AA seq 395 aa
MTAYDVEKEWSRISNTAAKTHQNNDFEGFTYQDFRTHVPIMDKEGFAAQTERCLERNERN
CLIGFTSGTSGNLKRCYYYYDCEVDEDSSRSNVFRSNGFIQPGDRCANLFTINLFSALNN
ITTMMAGNCGAHVVSVGDITLLTKSNFEALNSIKLNVLLGVPSTILQFIDAMQQHGVHID
IEKVVFNGEGLKTFQKKIIREAFGEQVSIVGVYGSSEGGILGFTNSPCHTEYEFLSDKYF
IEKEGDSILITSLTRENFTPLLRYRLGDTATLSMKGDKLYLTDIQREDMSFNFMGNLIGL
GIIQQAIKQTLGRTLEIQVHLSVTDARKELVTVFVQASEVDEDERARIETAIADIPDINE
AYQKDQGSVLVVRKDAREYAVSERGKMLYIIDRRN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgactgcctacgatgtagaaaaggaatggagcagaatttccaatactgccgctaaaacc
caccagaacaatgactttgaaggtttcacctaccaggacttcagaacccacgtaccgatc
atggacaaggaaggcttcgcggcacaaaccgaacgctgccttgagcgcaacgagcgaaac
tgcctgatcggctttaccagtggcaccagcggcaacctcaaacgctgttattactactac
gactgcgaagtcgatgaagacagctcacgctccaacgtctttcgcagcaacggctttatt
caacccggtgatcgctgcgccaacctgttcaccatcaacctgttttctgccctgaacaac
atcaccaccatgatggccggcaactgcggggcgcatgtagtgtcggtgggtgacatcacc
ctgctgaccaagagtaacttcgaggcactcaactcgatcaagctcaacgtactgcttggc
gtaccctcgaccatcctgcagttcatcgatgccatgcaacagcacggcgtgcacatcgac
atcgaaaaggtcgtcttcaatggcgagggcctgaaaaccttccagaagaaaatcatcagg
gaagcctttggcgaacaggtttccatcgtcggtgtgtatggcagttccgagggcggcatt
ctggggttcaccaacagcccttgccacaccgaatacgagtttctgtccgacaagtatttc
atcgaaaaagaaggcgacagcatcctcatcacctcgctgacccgcgagaacttcacaccg
ctgctcaggtatcgcctgggagacaccgccaccctttcgatgaagggcgacaagctctac
ctgaccgacatccagcgagaggacatgagcttcaacttcatgggcaacctcatcggtctg
ggcatcattcagcaagcgatcaaacagacactgggccgcacgctggaaatccaggtccac
ctgtcagtgactgacgcgcgcaaggaactggtgactgttttcgttcaggcctcggaagtt
gacgaagatgaacgcgccagaatcgaaaccgccatcgccgatattccggacatcaacgag
gcctatcagaaagaccagggcagcgtgctggttgtgcgcaaggatgccagagagtacgcc
gtctcggagcgaggcaaaatgctctacatcattgaccgcaggaattga

DBGET integrated database retrieval system