KEGG   Paracoccus aminophilus: JCM7686_1053Help
Entry
JCM7686_1053      CDS       T02792                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pami  Paracoccus aminophilus
Pathway
pami00010  Glycolysis / Gluconeogenesis
pami00020  Citrate cycle (TCA cycle)
pami00620  Pyruvate metabolism
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
pami01120  Microbial metabolism in diverse environments
pami01130  Biosynthesis of antibiotics
pami01200  Carbon metabolism
Module
pami_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JCM7686_1053
   00020 Citrate cycle (TCA cycle)
    JCM7686_1053
   00620 Pyruvate metabolism
    JCM7686_1053
Enzymes [BR:pami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     JCM7686_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AGT08162
UniProt: S5XSR0
LinkDB All DBs
Position
complement(1032471..1033802)
Genome map
AA seq 443 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDSVKSGDILAEIETDKATMEFEAVDEGVIGKLL
VAEGEAGVKVNTPIAVLLEEGESAADIGKAAAPAAAAPAAAAAPAPAAAAAPVAAAPAAT
ASAPAATGDKGGRVFASPLARRIAKEKGIDLAAIAGSGPHGRIVLADVQDAKPGAAKPAA
ASAPAASAPAPVAAAAAAAPTGASAETILKAYGDRQYEEVPLDGMRRTIAARLTEAKQTI
PHFYLRRSAKLDELLKFRGTLNKQLEARGVKLSVNDFIIKACANALQQVPDANAIWAGDR
IVKLKPSDVAVAVAIEGGLFTPVLKDAQQKSLSALSAEMKDLANRAKTKKLAPHEYQGGS
FAISNLGMFGIENFDAVINPPHGAILAVGAGIETPVVENGEIVIRNVMSMTLSVDHRVID
GALGAQLLDAIVKNLENPVAMLA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagaaatcctgatgcccgcgctttctccgacgatggaggaaggcacgctggcg
aaatggctggtcaaggaaggcgatagcgtcaaatccggcgatattctggccgagatcgaa
accgacaaggccacgatggaattcgaggccgtggacgagggcgtgatcggcaagcttctg
gtcgcggaaggcgaagcgggcgtgaaagtgaacacgcccatcgccgtcctgctggaagaa
ggcgaaagcgccgccgatatcggcaaggcagcggctccggctgcggctgcacctgcggca
gcggcggcccctgccccggcggcagcggcggctcctgtggctgcggcccccgctgcaacg
gcttcggctcccgcagcgacgggcgacaaaggcgggcgcgttttcgcctcgccgctcgcg
cgccgcatcgccaaggaaaaagggatcgacctcgcggccatcgcaggctcgggaccgcat
ggccggatcgttctggccgatgtgcaggacgccaaacccggcgcggcgaaacccgcagct
gcctcggctccggcagcttccgccccggctccggttgcggcagctgccgccgcagcgccg
accggcgcttcggccgagaccatcctcaaggcctatggcgaccgccaatacgaggaagtt
ccgctcgacgggatgcgccgcacgattgccgcgcgcctgaccgaggccaagcagaccatc
ccgcatttctatctgcgccgttcggccaagctcgacgaactcctgaagttccgcggcacg
ctgaacaagcagcttgaagcgcgcggcgtgaagctttcggtcaatgacttcatcatcaag
gcctgcgccaatgcgctccagcaggttccggacgcgaatgcgatctgggccggggatcgc
atcgtcaagctcaagccctcggatgtcgcggtcgccgtcgccatcgaaggcgggctcttc
accccggttctgaaggacgcgcagcagaaatcgctgtccgcgctttccgccgagatgaag
gatctggccaatcgcgccaagaccaagaagctcgcgccccatgaatatcagggcggcagc
ttcgccatctcgaacctcggcatgttcgggatcgagaatttcgacgcggtcatcaacccg
ccccatggcgcgattttggccgtcggtgccgggatcgagaccccggtcgtcgaaaatggc
gagatcgtcattcgcaatgtcatgtcgatgacgctctcggtcgatcaccgcgtgatcgac
ggggctctgggcgcgcagcttttggatgcgatcgtcaagaacctcgaaaacccggtggcg
atgctcgcctga

DBGET integrated database retrieval system