KEGG   Paracoccus aminophilus: JCM7686_1163Help
Entry
JCM7686_1163      CDS       T02792                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pami  Paracoccus aminophilus
Brite
KEGG Orthology (KO) [BR:pami00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JCM7686_1163
Enzymes [BR:pami01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JCM7686_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 NAD_binding_9 Thi4 DAO Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGT08272
UniProt: S5XSZ8
LinkDB All DBs
Position
complement(1151716..1153347)
Genome map
AA seq 543 aa AA seqDB search
MKKGSPAAVGEPLDRFSVRTAMLDANLKTQLKAYLERVTRPVEITAFADDGAKSQEMLGL
LADIDALSDKITLVRGEDAARVPSFALSSPGEEISLTFAGLPMGHEFTSLVLALLQVGGH
PPKLEQALLDQIRGLEGSFKFETYFSLSCQNCPDVVQALNLMAVLNPGIEHVAIDGALFQ
PEVEAREIMSVPTVFLNGQPFASGRMSAEEILAKIDTGAANRAADAINAQAPFEVLIVGG
GPAGAAAAVYAARKGIRTGVVAERFGGQVLDTMAIENFISVRHTEGPKLAGALEAHVRDY
EVEIMNAQAATRLETVAGGFQLTLASGAQLEAASVILSTGARWRKMGVPGEETYLNKGVA
FCPHCDGPLFKGKAIAVIGGGNSGVEAAIDLAGLVAHVTLIEYDQQLRADDVLQRKLRSL
KNVTILTSAKTTEVKGDGRRVTGLVYEDRASGESRELGLEGIFVQIGLVPNTDWLKGTVD
LSPRGEIIVDAHGATSLRGVFAAGDCTTTPYKQIVIAAGDGAKASLAAFDHLIRASAPEE
KAA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggctctccggcagcggtcggggagccattggaccgattttccgtgaggact
gccatgctcgacgccaatctgaagacccaactcaaagcctatctggagcgcgtgacccgg
ccggtggagatcaccgcttttgccgatgacggggcgaaatcgcaggagatgctcgggctg
ttggcggatatcgacgcattgtccgacaagatcaccctggtgcgcggcgaagatgcggcg
cgggtgccgtctttcgcgctgtcgagcccgggcgaggagatcagcctgaccttcgccggt
ctgccgatgggccatgagttcacctcgctggttctggcactgttgcaggtcgggggccat
ccgccgaagctggagcaggcgcttctcgatcagatccgcggcctcgagggcagcttcaaa
ttcgagacctatttctcgctgtcgtgccagaactgcccggatgtggtgcaggcgctcaat
ctgatggcggtgctcaatcccggcatcgaacatgtcgcgatcgacggggcgcttttccag
cccgaggtcgaggcgcgcgagatcatgtcggtgccgacggtgtttctcaacggccagccc
ttcgcttcgggtcgcatgagcgccgaggagattttggccaagatcgacaccggcgcggcc
aaccgcgctgcggatgcgatcaatgcgcaggcgccgttcgaggtgctgatcgttggcggc
ggccctgccggggcggcggcggcggtttatgccgcgcgtaagggcattcgcactggtgtc
gtggccgagcgttttggcgggcaggtgctcgatacgatggcgatcgagaacttcatctcg
gtgcgccataccgaagggccgaaactcgcgggcgcgcttgaggcccatgtgcgcgattac
gaggtcgagatcatgaatgcccaggccgcgacccggcttgagaccgtggcgggcgggttt
cagctgacccttgcttcgggcgctcaacttgaggcggcctcggtgatcctctcgaccggc
gcgcgctggcgcaagatgggtgtgcccggcgaagagacctatctgaacaagggcgtggcc
ttctgcccccattgcgacgggccgctcttcaaaggcaaggcgattgcggtgatcggcggc
ggcaattcgggcgtcgaggcggcgattgatctcgccggtctggtcgctcatgtcaccttg
atcgaatatgaccagcagctgcgcgccgatgatgtcctgcagcgcaagctgcgcagtctg
aagaatgtcacgatcctgacctcggccaagaccaccgaggtcaagggcgatggccgccgc
gtcaccgggctcgtctatgaagaccgggcgagcggggagagccgcgagttgggcctcgag
gggattttcgtgcagatcgggctggtgccgaacaccgattggctcaagggcacggttgat
ctgagcccgcgcggcgagatcatcgtcgacgcccatggcgcgacctcgctgcgcggcgtt
ttcgcggcgggcgattgcacgaccacgccttacaagcagatcgtgatcgcggcgggcgac
ggggcaaaagcctcgctggcggccttcgatcatctcatccgggcctcggctccggaggaa
aaggcggcctga

DBGET integrated database retrieval system