KEGG   Paracoccus aminophilus: JCM7686_2878Help
Entry
JCM7686_2878      CDS       T02792                                 

Definition
(GenBank) enoyl-(acyl-carrier protein) reductase I
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pami  Paracoccus aminophilus
Pathway
pami00061  Fatty acid biosynthesis
pami00780  Biotin metabolism
pami01100  Metabolic pathways
pami01130  Biosynthesis of antibiotics
pami01212  Fatty acid metabolism
Module
pami_M00083  Fatty acid biosynthesis, elongation
pami_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JCM7686_2878
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JCM7686_2878
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    JCM7686_2878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pami01004]
    JCM7686_2878
Enzymes [BR:pami01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     JCM7686_2878
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     JCM7686_2878
Lipid biosynthesis proteins [BR:pami01004]
 Fatty acid synthase
  Component type
   JCM7686_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AGT09934
UniProt: S5XRA0
LinkDB All DBs
Position
2982598..2983386
Genome map
AA seq 262 aa AA seqDB search
MTELLKGKRALVMGVANDRSIAWGIAKALHEAGAELAFSYQGEAFGKRVEPLAASLGSDF
LIDLDVVDDASLDAGFAEIEKRWGKFDILVHAIAFSDKNELTGRFINTTRDNFKNSMTIS
CFSLIDVARRAHGLMNPGSSILTLTYAGSNRVTPYYNVMGVAKAALESAVRYLANDLGPE
GIRVNAISPGPMKTLAGAAIGGARKTFRHTEANAPLRANATLEAIGGTAVWLSSDWGACT
TGETILVDGGYHVLGMPQSENL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgctcaagggaaaacgcgctctggtcatgggagtcgcgaatgaccgctcc
atcgcctggggcattgccaaggccttgcatgaggcgggggcagagcttgccttttcctat
cagggtgaagctttcggcaagcgggtcgaaccgctggccgcctcgcttggctcggatttc
ctgattgatctcgatgtcgtcgatgacgcctcgctcgatgccggttttgccgagatcgag
aagcgttggggcaagttcgacattctggtccatgccatcgccttctcggacaagaacgag
ctgaccgggcgtttcatcaacacgacgcgcgacaacttcaagaactccatgacgatctcg
tgtttctcgctgatcgacgtggcgcggcgcgcgcatgggctgatgaatccgggcagctcg
atcctcacgctgacctatgccggctcgaaccgggtgacgccctactacaacgtcatgggc
gtggccaaggcagcgctggaatcggcggtgcgctatctggccaatgacctcggccccgaa
ggcattcgcgtcaatgcgatcagccccggcccgatgaagacgctggcaggcgcggccatt
ggcggcgcacgcaagaccttccgccacaccgaggcgaacgcgcccctgcgcgccaatgcc
acgctggaggcgattggcggcacggcggtctggctgagctcggattggggtgcctgcact
acgggcgagaccattctggtcgatggcggctaccacgttctcggtatgccgcaatcggaa
aacctctga

DBGET integrated database retrieval system