KEGG   Paracoccus aminophilus: JCM7686_pAMI1p081Help
Entry
JCM7686_pAMI1p081 CDS       T02792                                 

Definition
(GenBank) methionine-gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
pami  Paracoccus aminophilus
Pathway
pami00270  Cysteine and methionine metabolism
pami00450  Selenocompound metabolism
pami01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pami00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    JCM7686_pAMI1p081
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    JCM7686_pAMI1p081
Enzymes [BR:pami01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     JCM7686_pAMI1p081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Met_gamma_lyase SelA GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGT10667
UniProt: S5XZF0
LinkDB All DBs
Position
pAMI1:complement(89376..90578)
Genome map
AA seq 400 aa AA seqDB search
MTETSRRNRQPGLSTRAIHLGYDPATENGALTPPIYMTSTYAFETAEQGSELFRGERKGY
IYGRTKNPTQTILEERIASLEGGETAIALGSGMAAISGTMLSLLDAGDEVVIDHTLYGNA
YAYFTQALPRWGISVKLADFTRPETLEAALGPKTKLVYFETPANPNLRVIDIAAVAAIAH
AHGAEVVVDNTFATPILQRPLEHGADIVLHSATKYIGGHGDVLAGLVVGRAETLQKVRQT
GLRWVTGATLSPFNCFLLLRGLKTLELRVERHSSSAMKVARLLEGHAKVASVSYPGLESF
AEHEIAKRQMSGFGGLISFELDGGMAEGMALMNRLELVTRAVSLGDAETLIQHPASMTHA
IYSAEEREKHGISDGLLRLSVGLENVDDILDDLERALDSL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacctcccgccgcaaccgccagcccggcctttcgacccgcgcgatccatctg
ggctatgatcccgcgaccgaaaacggcgcgctgacgccgccgatctacatgacctcgacc
tatgctttcgagacggccgagcagggctccgagctcttccggggtgagcgtaagggctat
atctacgggcggaccaagaacccgacccagaccattctcgaagagcgcatcgcgagcctt
gagggcggcgagaccgcgattgctttgggctcgggcatggccgcgatttcgggcacgatg
ctctcgcttctggatgcgggcgacgaggtcgtgatcgaccatacgctctacggcaatgcc
tatgcctatttcacgcaggcgctgccgcgttgggggatctcggtgaaactggccgatttc
acccggcccgagacattggaagcggcgcttggcccgaagacgaagctcgtctatttcgag
acccccgcgaacccgaacctgcgggtgatcgacattgccgcggttgctgcgatcgcccat
gcccatggcgccgaggtcgtcgttgacaacaccttcgccacgccgatcctgcagcgcccg
ctcgaacatggcgcggatatcgtgctgcattcggcgacgaaatatatcggcgggcatggt
gatgtgctggccggtctggtcgttggccgcgccgagacgctgcaaaaggtccgtcagacc
gggctgcgctgggtgacgggcgcgacgctgtcgcccttcaactgcttcctgcttttgcgc
gggctgaagacgctggaactgcgggtcgagcgtcattcgtcgtcggcgatgaaggttgcg
cggctgcttgaaggccacgccaaggtcgcgtcggtctcttatccggggctcgaaagcttc
gccgagcatgagatcgccaagcggcagatgtcgggctttggcgggctgatctcgttcgag
ctcgacggggggatggccgaaggcatggcgctgatgaaccggctggagctggtaacccgc
gcggtcagccttggcgatgcggaaactctgatccagcatccggcctcgatgacccatgcg
atttacagcgcggaagagcgcgaaaagcatgggatttcggatgggcttttgcggctgtcg
gtcgggctggaaaatgtcgatgatattctcgacgatctcgagcgcgctttggatagcctt
taa

DBGET integrated database retrieval system