KEGG   Paracoccus aminovorans: JCM7685_0175Help
Entry
JCM7685_0175      CDS       T05468                                 

Gene name
thiO
Definition
(GenBank) glycine oxidase, thiamine biosynthesis protein ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00730  Thiamine metabolism
pamn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    JCM7685_0175 (thiO)
Enzymes [BR:pamn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     JCM7685_0175 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 3HCDH_N Pyr_redox ApbA
Motif
Other DBs
NCBI-ProteinID: CQR84761
LinkDB All DBs
Position
I:177217..178194
Genome map
AA seq 325 aa AA seqDB search
MTRITILGAGVMGLCIASELAARGMPSRLIDPAGKPGAQACSWRAGGMLAPYCEAESAEP
AVLRLGLDAADWWQAQGAEVTRRGTLVLAPSRDRAELDRFARLTQAHRAVNGDEIAALEP
DLAGRFPRGLHFATEAHLDPRAALLTLRDRLRAQGVAIETEGTPTGLVVDARGLAARDQL
ADLRGVRGEMLVIRCPEVALTRTIRLLHPRIPLYLVPRGDGIYMIGATMLETGGKYRVTA
RSAVEMLSAAYALHPGFAEAEILELGADARPAFPDNLPRLRRRGGTLYANGLYRHGYLLA
PAVARMAADYLLEGRKPEFMDEDHP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgacccgaataacaatccttggtgcgggcgtcatgggtctttgcatcgcctcggaactg
gcggcgcgggggatgccgtcgcgacttatcgatccggcgggcaagcccggggcgcaggct
tgcagctggcgcgccggcggcatgctggccccctattgcgaggccgaaagcgccgaaccg
gcggtgctgcgcctggggctcgatgcggccgactggtggcaggcgcagggcgccgaggtc
acgcggcgcggcacgctggtgttggcgccctcgcgcgaccgggccgagctggaccgcttc
gcccgcctgacccaggcgcatcgggccgtgaacggcgacgaaattgcggcgctggagccc
gacctggccggccgctttccgcgcgggctgcatttcgccaccgaggcgcatctggacccg
cgcgccgcgctgctgaccctgcgcgaccggcttcgggcgcagggcgtcgccatcgaaacc
gagggcacgcccacgggcttggtcgtagacgcgcgcggtctcgcggcgcgggaccagctt
gccgacctgcgcggcgtgcgcggcgagatgctggtgatccgctgccccgaggtcgccctg
acccgcaccatccggctgctgcatccgcgcatacccctatatcttgttccgcggggggat
ggcatctacatgatcggcgccaccatgctggaaaccggcggcaaataccgcgtcaccgcc
cgctcggcggtggaaatgctgtccgccgcctatgccctgcatcccggctttgccgaggcc
gagatcctggaactcggcgccgatgcccgcccggcatttcccgacaacctgccccgcctg
cgccggcgcggcggcacgctttacgcaaacggcctttaccgccacggctatcttctggcc
cccgccgtggcccgcatggccgccgactatcttctcgagggccggaaaccggagttcatg
gatgaagatcacccttaa

DBGET integrated database retrieval system