KEGG   Paracoccus aminovorans: JCM7685_1119Help
Entry
JCM7685_1119      CDS       T05468                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00473  D-Alanine metabolism
pamn00550  Peptidoglycan biosynthesis
pamn01100  Metabolic pathways
pamn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    JCM7685_1119
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JCM7685_1119
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    JCM7685_1119
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pamn01011]
    JCM7685_1119
Enzymes [BR:pamn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JCM7685_1119
Peptidoglycan biosynthesis and degradation proteins [BR:pamn01011]
 Precursor biosynthesis
  Amino acid ligase
   JCM7685_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: CQR85696
LinkDB All DBs
Position
I:1108973..1109896
Genome map
AA seq 307 aa AA seqDB search
MAGRSSRTAPKVVVLMGGPSAEREVSLSSGRECAKALRQAGYEVVELDAGRDLPARLVDA
APDVVFNALHGRWGEDGCVQGLMEWLGLRYTHSGVLASALAMDKSRAKQAFREAGIPVVE
SVIADAAEVCTRHVLPPPYVVKPNDEGSSVGVYIVHEAANAPPQLSDQMPARVMVETYAP
GRELTVAVLGDRALGVTEIVTEGWYDYDAKYKPGGSRHVVPAEIPAEIDAACRDFAVRAH
QALGCRGLSRSDFRWDESRGLAGLIILETNTQPGMTPTSLAPEQAAHVGMDFPALCRWIV
EEALCRA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggcaggtcgagcaggacagccccgaaagtcgtggtcctgatgggcggaccctcg
gccgagcgcgaggtttccctctcgtccgggcgggaatgcgcgaaggcgctgcggcaggcg
ggctatgaagtcgtcgaattggatgcgggcagggatctgcccgcgcgtctggtcgatgcc
gcgccggacgtggtcttcaacgcgctgcacggccgttggggcgaggacggctgcgtccag
ggcctgatggagtggctggggctgcgctacacccattccggcgtgctggcctcggcgctg
gccatggacaagtcccgggcgaagcaggcgtttcgcgaggcgggcattcctgtcgtcgaa
agcgtcatcgccgacgcggccgaggtgtgcacccgccacgtcctgccgccgccctatgtc
gtcaagccgaatgacgagggctcctcggtcggggtctatatcgtccacgaggccgccaac
gccccgccgcagctctcggaccagatgcccgcgcgggtcatggtcgagacctatgccccc
ggccgcgagttgaccgtcgccgtgctgggcgaccgggcgctcggcgtgaccgagatcgtc
accgagggctggtacgactacgacgcgaaatacaagcccggcggctcgcgccacgtcgtc
ccggccgagatcccggccgagatcgatgccgcctgccgcgacttcgccgtcagggcgcat
caggcgctggggtgccgcggcctgtcgcgcagcgatttccgctgggacgaatcgcgcggc
ctggccgggctgatcatccttgaaaccaacacccagccggggatgacgccgacctcgctg
gcgccggagcaggcggcgcatgtcggcatggactttcccgcgctctgccgctggatcgtc
gaggaggcgctatgcagggcttga

DBGET integrated database retrieval system