KEGG   Paracoccus aminovorans: JCM7685_2010Help
Entry
JCM7685_2010      CDS       T05468                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00240  Pyrimidine metabolism
pamn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    JCM7685_2010 (tdk)
Enzymes [BR:pamn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     JCM7685_2010 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK TruB_C
Motif
Other DBs
NCBI-ProteinID: CQR86572
LinkDB All DBs
Position
I:2034427..2035002
Genome map
AA seq 191 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQASYNYRERGMHTLLLTAALDDRTGPGVIASRIGISEPAL
GFAPDTDLFALIRDEAAGAACIFVDEAQFLTPAQVWQLARAADDLGRPVMCYGLRVDFRG
ELFPGSAALLALADDLREIRTICHCGRKATMVVRQDAHGRALRQGAQVQIGGNETYVSLC
RRHWRAAMEEN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttccattactcgaccatgaatgccggcaagagcacgctcctgctg
caggcatcatacaattaccgcgagcgcggcatgcacacgctgctgctgaccgcggcgctg
gacgaccgcaccggcccgggcgtgatcgccagccgcatcggcatttccgagccggccctg
ggctttgcccccgacaccgatcttttcgcgctgatccgcgacgaagccgccggcgccgcc
tgcatcttcgtggacgaggcgcagttcctgacccccgcgcaggtctggcaactggcccgc
gccgccgacgacctgggccggccggtcatgtgctatggcctccgcgtcgatttccggggc
gagctgtttcccggctcggcggcgctgctggcgctggccgacgacctgcgcgagatccgc
accatctgccattgcggccgcaaggccacgatggtcgtgcgccaggacgcgcatggccgg
gcgctgcgccagggcgcgcaggtgcagatcggcggcaacgaaacctatgtctcgctttgc
cgccggcactggcgcgcagcgatggaggaaaactga

DBGET integrated database retrieval system