KEGG   Paracoccus aminovorans: JCM7685_2120Help
Entry
JCM7685_2120      CDS       T05468                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00540  Lipopolysaccharide biosynthesis
pamn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    JCM7685_2120 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pamn01003]
    JCM7685_2120 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:pamn01005]
    JCM7685_2120 (lpxB)
Enzymes [BR:pamn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     JCM7685_2120 (lpxB)
Glycosyltransferases [BR:pamn01003]
 Polysaccharide
  Bacterial polysaccharide
   JCM7685_2120 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:pamn01005]
 Lipid A
  JCM7685_2120 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CQR86678
LinkDB All DBs
Position
I:complement(2146000..2147163)
Genome map
AA seq 387 aa AA seqDB search
MKFFLIAGEPSGDNLGGALMAGLKTLDPGAEFLGVGGPAMAARGLDSRFPMEELSLMGIW
EVLPKYRALKARIAETARAVAEAKPDALITIDSPDFCLRVARAARALDPDLRTVHYVAPS
VWAWRPGRARKMAEVIDHVLAILPFEPPLMQAAGMSCDFVGHPIVAEPVAGAAEAAAFRV
TNDIAADAPLVLCLPGSRRTEVGRLGPRFDEALMRLRDRVPEIRVVIPTVRGVSGLVREM
ARRWPTAPVVVESPEERRAAFAAADLALAASGTVSLDLAANGVPMVVGYDVAPLSRLIIG
LLLRTDTVTLVNLVSETRAVPEFLGRACQPGPMSQALYRLIEMPEERAEQVAAMELTMQR
LGRGGEAPGLRAARSVLSAISSAPRPR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttcctgatcgccggcgagccctcgggcgacaatctgggcggcgccttgatg
gccgggctgaaaacgctcgatccgggtgccgaattcctgggcgtgggcgggccggccatg
gcggctcgggggctggacagccgctttcccatggaagagctgagcctgatgggcatctgg
gaggtgctgccgaaataccgcgcgctgaaggcgcgcatcgccgagaccgcccgcgccgtg
gccgaggccaagccggatgcgctgatcaccatcgacagcccggatttctgcctgcgtgtg
gcgcgggcggcgcgggcgctggatccggacctgcgcaccgtccattacgtcgctccctcg
gtctgggcctggcgtcccgggcgggcgaggaagatggccgaggtgatcgatcatgtgctg
gcgatcctgcccttcgagccgcccctgatgcaggcggccggcatgagctgcgatttcgtc
ggccaccccatcgtcgccgagccggtggcgggtgcggccgaggccgccgcctttcgggtg
acgaacgacattgcggccgatgcgccgctggtgctgtgcctgccggggtcgcggcggacc
gaggtggggcggctgggtccgcgcttcgacgaggcgctgatgcggctgcgcgaccgcgtg
cccgagatccgggtggtgattcccacggtccgcggcgtctcgggcctggtgcgcgagatg
gcgcgccgttggccgacggcgccggtggtggtcgaaagccccgaggaaaggcgcgcggcc
tttgccgccgcggatctggcgctggcggcctcggggacggtcagcctggatctggcggcg
aacggcgtgccgatggtggtcggctatgacgtggcgccgctgagccgcctgatcatcggc
ctgctgctgcggaccgatacggtgacgctggtgaacctggtcagcgagacccgcgcggtg
cccgagttcctgggccgcgcctgccagccggggccgatgtcgcaggcgctctatcggctg
atcgagatgcccgaggagcgggccgagcaggtcgcggcgatggagctgaccatgcagcgg
ctggggcgcggcggcgaggctccgggcctgcgcgccgcgcggtccgtgctgagcgcgatc
agttctgcgccgcgaccacgatga

DBGET integrated database retrieval system