KEGG   Paracoccus aminovorans: pAMV1p0052
Entry
pAMV1p0052        CDS       T05468                                 

Definition
(GenBank) type VI secretion system effector Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pamn  Paracoccus aminovorans
Pathway
pamn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    pAMV1p0052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pamn02044]
    pAMV1p0052
Secretion system [BR:pamn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   pAMV1p0052
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CQR83840
LinkDB
Position
II:60601..61098
AA seq 165 aa
MAVDIFLKLSNNIKGESQDDTHRDEIDVLAWNWGLTQSGTTHVGSGGGGGKVNVQDITLT
KYVDLATNDLIKRCTNGEHIENGELIVRKSGGAAPVEYFRIKMGKIMITSYSTGGAKDGL
DRIQETLTLNFRQFEVSYTLQEDTGAAGAETLAGWDIAENKEWSA
NT seq 498 nt   +upstreamnt  +downstreamnt
atggctgtcgatatctttctgaaactttccaacaacatcaagggcgagtcccaggacgac
acccaccgcgacgaaatcgacgtgctggcctggaactggggcctgacccagtcgggcacc
acgcatgtcggctcgggcggcggcggcggcaaggtcaacgtgcaggatattaccctgacg
aaatacgtcgacctggcgaccaacgacctgatcaagcgctgcaccaacggcgagcacatc
gagaacggcgagctgatcgtgcgcaagtcgggcggcgcggcgccggtcgaatatttccgc
atcaagatgggcaagatcatgatcaccagctattcgactggtggcgccaaggacggtctt
gaccgcatccaggaaaccctgaccctgaacttccgccagttcgaggtgtcctatacgctg
caagaggataccggtgccgccggcgccgagaccctggccggctgggacatcgccgagaac
aaggagtggagcgcctaa

DBGET integrated database retrieval system