KEGG   Paracoccus aminovorans: pAMV3p0090Help
Entry
pAMV3p0090        CDS       T05468                                 

Definition
(GenBank) hypothetical protein
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00061  Fatty acid biosynthesis
pamn00780  Biotin metabolism
pamn01100  Metabolic pathways
pamn01212  Fatty acid metabolism
Module
pamn_M00083  Fatty acid biosynthesis, elongation
pamn_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    pAMV3p0090
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    pAMV3p0090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pamn01004]
    pAMV3p0090
Enzymes [BR:pamn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     pAMV3p0090
Lipid biosynthesis proteins [BR:pamn01004]
 Fatty acid synthase
  Component type
   pAMV3p0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CQR84035
LinkDB All DBs
Position
IV:93777..94829
Genome map
AA seq 350 aa AA seqDB search
MQITASGLSTAFGKGLAAIIAAAEEDLLPLARRSDFIGADFRPQLCAFAPGATLDGAKAR
MRALVAEALQDLGESFAALGRTWPAVGLVLLTPCGDPGLEEAQAQAIAGDIVQELRNSGW
IPPDGPVVALRGDAATAVPALRAAAELTAQGRPVLLIAADSFCCRRRLNALCDANGLFSR
DNPWGLVPGEAAIAALVEADAVHAPALQVAALAEAEEPVPAQAERDSAFTGLSDAALAVL
DQAERLGLAAPQALFSDWNNSRYRASELSYAMVRMTGLLAQEGIEPIHPAQRFGHVGAGW
LATACATAREASAKGAAGPALVLCGNERDGGRGAFILQWPAAAEVLPFPG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcacggcgtccggcctgtccacggctttcggcaaaggcctggccgcgatcatc
gcggcggccgaggaggacctgttgccgttggcccgccggtcggatttcatcggcgccgac
ttccggccgcagctgtgcgccttcgcccccggcgccacgctggacggggccaaggcccgg
atgcgggcgctggtcgccgaggcgttgcaggatctgggcgagtccttcgctgctttgggc
cggacctggccggcggtggggctggtgctgctgacaccctgcggcgatccggggctggag
gaagcgcaggcgcaggccatcgccggggacatcgtgcaggagctgcgcaacagcggctgg
atccctccggatggtccggtggtggcgctgcggggcgacgccgcgaccgcggtgcccgcg
ctgcgggccgcggccgaactgacggcgcagggccggcccgtgctgctgatcgcggcggac
agtttctgctgccggcgccggctgaatgcgctttgcgacgcgaatgggctgttcagccgc
gacaatccctggggattggtccccggcgaggccgccatcgccgcgctggtcgaggcggat
gccgtgcacgcacccgccttgcaggtggccgccttggccgaagccgaagagccggtgccc
gcccaagccgaacgcgacagcgccttcaccggcttgagcgatgcggcgctggcggtgctg
gaccaggccgagcgcctggggcttgccgcgccgcaggcgcttttcagcgattggaacaac
agccgctaccgcgcctcggaactgtcctatgctatggtcaggatgaccggccttctggcg
caggaggggatcgagccgatccatccggcgcaaagattcggccatgtcggtgccggctgg
ctggccaccgcctgcgccaccgcgcgcgaagcgtcggccaagggcgcggccggtcccgcg
ctggtgctgtgcggcaacgaacgcgacggcggccgcggcgccttcatcctgcagtggccc
gctgccgccgaggtcctgccctttccgggctga

DBGET integrated database retrieval system