KEGG   Paracoccus aminovorans: pAMV3p0493Help
Entry
pAMV3p0493        CDS       T05468                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pamn  Paracoccus aminovorans
Pathway
pamn00500  Starch and sucrose metabolism
pamn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    pAMV3p0493
Enzymes [BR:pamn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     pAMV3p0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: CQR84438
LinkDB All DBs
Position
IV:complement(559617..560879)
Genome map
AA seq 420 aa AA seqDB search
MAAPDPAWIAAQRLASARALRSACSATHLTRRREGFGWTVRPAAGSVLASPRAADWNPEP
DYFHHWIRDSAIVLRAVPLAIRADPPARGFWRRFVGDFIDFSLAISDPARRGPAENPLRA
TCRPGLAPFLRPDAELAAMAGDAWLQEPRVAPDGTPDLEQWSRPQDDGPALRASALMAVL
AELPEAAGTLAHALIARDIAHVLRVAGRPCIGPWEEEPPRRTTFTLLAQWDALDRAGHQA
AADRLAGLIETTADPATGGWRESIEAPEGGLDSATCLAILHAGRDHGPFALTAPRTRATA
AGLERIFAGLYPINRDRAVPAIGRFAGDVYCGGNPWYPVTLGFAELRYRIAAQTGERDAF
ARAEAWMALIQTVAPDPGPLPEQFDRASGAPASCLDLAWSAAAFLAAVEAREAAVQAMGR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgcccgatccggcttggatcgcggcgcagcgcctggcctcggcccgcgccctg
cgcagcgcctgctcggccacgcatctgacccgccggcgcgagggcttcggctggaccgtg
cggccggcggcgggctcggtcctggcctcgccgcgggcggcggactggaaccccgagccg
gactatttccaccattggatccgcgattccgccatcgtgctgcgcgcggtgccgctggcg
atccgggccgatccgccggcgcgggggttctggcggcgcttcgtcggcgacttcatcgac
ttttccctggcgatttccgacccggcgcgccgggggccggcggaaaacccgctgcgcgcc
acctgccggcccggcctcgccccattcctgcgccccgacgcggaactggcggcgatggcg
ggcgatgcctggctgcaggagccgcgcgtcgcgcccgacggcacgcccgacctggaacag
tggagccggccgcaggacgacggcccggcgctgcgggcctcggcgctgatggcggttctg
gcggaactgcccgaggcggccggcacgctggcccatgcgctgatcgcccgcgacatcgcc
catgtgctgcgcgtggccggccggccctgcatcggtccctgggaggaagagccgccgcgg
cgcaccaccttcaccctgctggcgcaatgggatgcgctggaccgcgccggccatcaggcc
gctgccgaccggctggcgggcctgatcgaaaccactgccgacccggcgaccggcggctgg
cgcgaaagcatcgaggcgcccgagggcgggctcgacagcgccacctgcctggccatcctg
cacgccggccgcgaccacggtcctttcgccctgacggcgccgcggacccgggccacggcg
gcggggctggaacggatctttgccgggctctacccgatcaaccgcgaccgcgcggtgcct
gccatcggccgtttcgccggcgatgtctattgcggcggcaacccctggtatccggtgacg
ctgggctttgccgaactgcgttaccgcatcgccgcccagaccggcgagcgcgacgccttc
gcccgcgccgaggcctggatggccctgatccagacggtggcaccggaccccggcccgctg
cccgagcagttcgaccgcgccagcggcgccccggcctcttgcctcgacctggcctggtcg
gcggcggcctttctcgcagccgtcgaggcgcgggaggcggcggttcaggccatgggcaga
tag

DBGET integrated database retrieval system