KEGG   Podospora anserina: PODANSg09388Help
Entry
PODANSg09388      CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
pan  Podospora anserina
Pathway
pan00040  Pentose and glucuronate interconversions
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PODANSg09388
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     PODANSg09388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N AlaDh_PNT_C Pyr_redox_2 PALP HI0933_like
Motif
Other DBs
NCBI-GeneID: 6197159
NCBI-ProteinID: XP_001912341
UniProt: B2A9R1
LinkDB All DBs
Position
1
AA seq 377 aa AA seqDB search
MSSNLSFVLNKPNDVSFEERPIPKLKSPHDVLVAINYTGICGSDVHYWVHGAIGHFVVKD
PMVLGHESAGTVVEVGSGVTDLKKGDRVALEPGYPCRRCPDCLGGSYNLCHEMVFAATPP
YDGTLTGFWSAPHDFCYKLPDNVSLQEGALIEPLAVAVHIVKQARVQPGNSVVVMGAGPV
GLLCAAVAASFGATKIVQVDIVQSKLDFAKSFAATHTYLSQRVSAEENAKNLIASANLGK
GADVVIDASGAEPSIQTSLHVVRMGGTYVQGGMGKSDINFPIMALCLKEVTARGSFRYGS
GDYKLAIELVAAGKVDVKKLVNGVVAFKDAESAFKKVKEGEVIKILIAGPNEKVETELDT
SVDPAKLEAAKGNTGCC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaacctttctttcgtcctcaacaagcccaatgacgtctccttcgaggagcgc
ccaatccccaagctcaagtccccccacgatgttctcgtcgccatcaactacaccggcatc
tgcggctctgatgtccactactgggtccacggcgccattggccacttcgtcgtgaaggac
cccatggtcctcggccacgagtccgccggtaccgtcgttgaggtcggctccggagtcaca
gacctcaagaagggcgaccgtgttgccctcgagcccggctacccctgccgccgctgcccc
gactgcctcggcggcagctacaacctctgccacgagatggtcttcgccgccactcccccc
tacgacggcacgctaacaggcttctggtccgctccccacgacttctgctataagctgccc
gacaacgtgtctctccaagagggcgccctcatcgagcctctcgccgtggctgttcacatc
gtcaagcaggcccgcgtccagcctggcaacagcgttgtcgtcatgggcgccggccccgtc
ggcctcctctgtgccgccgtcgctgcctccttcggcgccaccaagatcgtccaggtcgac
attgtccagtcgaaactggactttgccaagtccttcgccgccacccacacctacctctcc
cagcgtgtctccgccgaggagaatgccaagaacctcatcgcctctgccaacctcggtaag
ggcgccgacgttgtcattgacgcctccggtgccgagcctagcatccagacctccctccac
gttgtccgcatgggtggcacctacgtccagggcggcatgggcaagtcggacatcaacttc
cctatcatggctctctgcctgaaggaggtgacggcccgtggctcgttccgctacggcagc
ggtgattacaagcttgctattgagctcgtggccgctggcaaggttgacgtcaagaagctc
gtcaatggcgtcgttgcgttcaaggatgccgagtcggcgttcaagaaggtcaaggagggt
gaggtcatcaagattctcattgccggccccaacgagaaggtggagaccgagcttgacacc
tctgttgaccctgccaagcttgaggcggccaagggcaacactggctgctgctaa

DBGET integrated database retrieval system