KEGG   Podospora anserina: PODANSg09931Help
Entry
PODANSg09931      CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pan  Podospora anserina
Pathway
pan00052  Galactose metabolism
pan00500  Starch and sucrose metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PODANSg09931
   00500 Starch and sucrose metabolism
    PODANSg09931
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PODANSg09931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 6197307
NCBI-ProteinID: XP_001912882
UniProt: B2ABA2
LinkDB All DBs
Position
1
AA seq 1106 aa AA seqDB search
MAFNSTLASAELFAGNSITWDHQSLEPGTSELPTASSESRAGLDFEDARVSSHLGLGLDF
GQDYFKVEVLVFVAALSLGFKLYNRRVPRQGILSKATSLLATMALLTSISLLLTSSLLPS
GTSGHKGPPVVPAKFLQTASPTTSSVPQFTVPASADKGKDVEANIDDPLAANPQLVCPGY
SASNVQNTKNGFTADLDLAGPACNVYGNDIEHLSLLVEFQANERVHLQIEPRYISKENET
WFRLPEVLIPKPQNDPLCEEHNSDFVVSWSNDPTFSFTVKRKATDDTLFTTEGSKLVYED
QFIEFVSPLPESYNLYGLGEVIHGFRLGNNLTRTLFAADVGNDIDWNIYGSHPIYHDTRY
FTTDESGKLTYAPYADDKTARYTSYTHGVYLRNAHPQEVLLRQPGITWRTLGGSIDLYFY
SGPRAEDVTTKYQESAVGLPAMQQYWTLGYHQCRWGYTGWQRLQEVIDNFAKFEIPLETV
WGGSFFPFIFQNDHDTWNYTEGEEFMNRLHKNHQHWVPIVDSAIYAPNPEDEEDRYPTYE
RGLEADAFVKNPDGSIYYGAVWPGYTVFPDWVGAVLGEAGTIDWWIDEISRWSKNISFDG
IWIDMSEVASFCVGSCGTGNLTLNPAHPPFKLPGEPGNLVLRYPEGFAKTNETEAISATK
AIITQSYGPTATAVPTVTTTTTTKNFYRSTPTPGARNINWPPYVINNYHGDIGVHALSPN
STHNGGYLEYDFHNLFGHQVLNATYSALLQVQKGVRPFIIGRGTFAGSGKWAGHWGGDNE
ALWAFLYFSIPQALSFSIFGFPMFGVDTCGFNGNTNYELCSRWMQLSAFFPFYRNHNAMG
AIDQEPYRWSSVIDATKSAMAIRYALLPYMYTLMTQASLAGSTVMRALAWEFPNEPWLAD
ADRQFMLGDAIMVTPCLEQGADTVKGVFPGVGEGEVWYDWYTKGKVSYGVGPGENVTIGA
ELGHIPVYVRGGKVVPLQEPGMTTAESRQNPWGLLVGLDGTGRAEGKLYLDDGVSLEPEE
VSWISFTASNNFLKVEPLGNYPDTNPLRNATVMGLEHEPKQVWLDGEVLEQEHWSYDAGR
CVLELFELKEKFSGGAWVQGWEITWE
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaacagtaccttggcttcggccgagttatttgccggtaacagtatcacctgg
gaccatcagagtttggagccaggaaccagcgagctcccaactgcttcttccgagtcacgg
gccggtctagacttcgaagatgctcgcgtatcctcacatctgggtctggggctcgacttc
ggccaggactatttcaaggtggaagtcctcgtctttgtcgctgctcttagtttgggcttc
aaattgtacaaccgcagggttcccagacaaggcatcctttccaaagccacttcgttgcta
gccaccatggctttgcttacttcgatatcgctccttttgacctcgtcgttgctgccgagt
ggtacttctgggcacaaggggccaccagtggtcccggccaagtttcttcagacggcgtct
cccaccaccagctcagtcccacagttcacagtccctgcgtctgccgacaaagggaaggac
gttgaagccaacatagacgacccccttgccgctaacccgcagctggtatgtcctgggtac
tctgcatccaacgtccaaaacacgaaaaacgggtttactgccgatcttgaccttgccggc
ccagcatgcaacgtctacggcaacgacatcgagcacctctccttactggtggagtttcag
gccaacgaaagggttcaccttcagattgagccacggtacatctcgaaggagaatgaaacg
tggttcagattacccgaagtgttgataccaaaacctcaaaacgatcctctttgcgaggag
cacaacagcgactttgtggtctcgtggtcaaacgacccgacattctccttcacggtgaag
cgaaaggcaactgacgacacgctctttacaaccgaggggagcaagctcgtctacgaagat
cagttcatcgagtttgtgtcccctctgcccgagagctacaacctgtatggtctcggtgaa
gttattcatggcttccgcttgggcaacaatctcaccaggacactctttgcggcagatgtt
ggcaacgacatcgactggaacatctatggcagtcatcctatctatcatgacacaagatac
ttcaccaccgatgagtcggggaaattgacatatgcgccttatgccgacgacaagacggcc
agatacacatcgtatacacatggtgtctatcttcgcaacgctcatccacaagaggtgctt
ctgcggcaacctggtattacttggagaacacttggtggcagcatcgatctctatttttac
agcggtcctcgggctgaagatgtcacgaccaagtaccaagagagcgctgttggccttccg
gctatgcagcagtactggactttgggataccatcagtgccgctggggctatactggctgg
caacgtttgcaagaggttattgacaactttgcaaagtttgagattccgcttgagacggtc
tggggtgggtctttctttcccttcatattccagaacgaccatgatacctggaactacacc
gaaggagaggagttcatgaacaggcttcacaagaatcaccaacactgggttcccattgtt
gactctgccatctatgcgcctaacccagaggatgaggaagatcgctatcctacctatgag
cgggggctggaggcagatgcctttgtgaagaatcctgatgggtcgatttactatggggct
gtgtggcctggttatacggtttttcctgactgggttggtgctgtgcttggtgaggctggg
actatcgactggtggattgatgagatttcgaggtggagcaagaatatctcgttcgatggt
atctggatcgacatgtccgaagttgcctccttctgcgttggcagctgcggcaccggaaac
ttgacactcaatcctgcccatccgcccttcaagctgcccggtgagcctggtaatcttgtc
ttgagataccccgaaggcttcgcgaagacaaacgaaaccgaagccatctcagcgacaaag
gcgatcatcacccagagctacgggccaaccgcgaccgccgtccccaccgtcaccacaacc
acaacaacgaagaacttctaccggagcacacccactcctggcgcaagaaacatcaactgg
cccccgtacgtgatcaacaactatcatggcgacataggagtccacgccctgagcccgaac
tcgacgcataatggcggttatctcgagtacgatttccacaacctcttcggtcaccaagtc
ctcaacgcgacctactcagctctgctccaagtccaaaagggcgtccgccccttcatcatc
ggccgcggcaccttcgccggctcaggcaagtgggctggccactggggcggtgacaatgag
gccctctgggcatttttgtactttagcatcccgcaagcactgtccttctccatctttggc
ttccccatgtttggggtcgacacgtgcggcttcaacggcaacacaaactatgagctctgc
tcgcggtggatgcagctcagcgcgtttttccccttttatcggaatcacaatgcgatgggg
gcgattgaccaggagccgtacaggtggagcagtgtgattgacgctaccaagtcggcgatg
gcgatacggtatgcgctgctgccgtatatgtacacgctcatgacccaggcttctctcgct
ggcagcaccgtcatgcgtgctcttgcgtgggagtttcccaatgagccgtggcttgctgat
gctgacaggcagttcatgttgggagatgcgattatggttacgccctgtttggagcagggg
gcggatacggtgaagggagttttccccggggtgggagagggggaggtgtggtatgattgg
tataccaaggggaaggtgagttatggggttggacccggggagaatgtcactattggggcg
gagttggggcatattcctgtctatgtgaggggtgggaaggttgttccgttgcaggaacct
ggaatgactacagcggagagtaggcagaatccttggggactgttggtgggattggatggg
actggacgggcggaggggaagttgtatttggatgatggggtcagtctggagccggaggag
gtgagctggatttcgtttactgcctcgaacaacttcctcaaggtcgagccgctgggtaac
tacccggacaccaacccccttcgcaacgccacggtcatgggtctggagcacgagcccaag
caggtgtggcttgatggtgaggtgctggagcaggagcattggagttatgatgcggggagg
tgtgtgttggagttgtttgagctgaaggagaagttttctggtggtgcttgggtgcagggg
tgggagattacttgggagtag

DBGET integrated database retrieval system