KEGG   Podospora anserina: PODANSg1229Help
Entry
PODANSg1229       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
Organism
pan  Podospora anserina
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 6188251
NCBI-ProteinID: XP_001904211
UniProt: B2AEX2
LinkDB All DBs
Position
5
AA seq 1118 aa AA seqDB search
MSDYNGNGHKASNGTGVTALNGSSSSHGSSSAHQSREGMELVASQAKPRPTPLDLKPTGA
NRAGVANAFERYGQVMQSSVAPLPNQHGADTFSRSKKWGKLRDDVKQLRLADYKTLLGVV
KAKVKGEKIKDDKTMAMEKVIQLVSNLPSNSKTRTELTNSFLSELWYTLEHPPSMYVGEK
FQYRQADGSYNNVMFPQLGAAGTSYSRSVAANVVRQGALPDPNLIFESVMKRTEYTEHPN
NVSSILWYWASIIIHDLFWTDYRDMSKSKTSSYLDLSPLYGSNQDMQDTIRTFKDGKIKP
DCFADKRLLGMPPGVGVFLIMFNRVHNHVAENLARINEDGRFSPPSPNLEGEKKEAAWKK
YDNDLFQHARLITSGLYINITLLDYVRNIVNLNRVDTTWTLDPRVETGINVDTKEGAERG
TGNVCSAEFNLCYRWHSCISAKDDKWIQDFYYDLFKKPGKDLSIHELIMGFGKFEGMIPD
DPAERPFNKFQRGPDGKFNDDDLVNCISDAIEDPAGSFGARNVPESMRAVEILGIIQGRR
WNVAGLNEFRKHFGLKPYEKFEDINSDPGVAESLRRLYDHPDFVELYPGLVAEERKEPMV
PGVGIAPTYTISRVVLSDAVCLVRGDRHYTIDYTPRNLTNWGFNEVQYDLNINHGCVFYK
LFLRAFPNHFKYNSVYAHYPMVTPSENSKILKDLKRAHLFDFSRPGRIATPTEVTSYDGA
QRIFAAEDKFKSTWNAGVAGIRAKASPELSGDAAVHDRHRTTASRSLFTPELGTQIKAFY
ESLTDKLLTTKSYTLVPGSKFADLVRDIANIVPTHFAASVFGLPLTTKENRKGIYTEHEL
YAVLQIIASALFVDSEPVKLFPVVEAAKTVAGQLGTLVDKTVKSPKAAKNSVLNTFGVNF
IKELKKAGLATHDITWNHVLPTAAALASSQGELFTQAVDYYLSPEGAAHVADITAIASQP
SSSQNDALLLGYVLEGIRLSGSARSHFEATTAGTVTASNGTELQIQPGSKVTINSSTASR
DAAYFPEPETVNPRRPLDKYIHFDAGPHAFLGKEISQIALTEMFRALFKRKNVRRAPGPQ
GELKKVPRADGNGVDYLREDWGALTPFPVTMKVMWDEV
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattacaacggcaacgggcacaaggcctcgaacggcacgggagttactgctctc
aatggctcaagctcgagccacgggagctcgtctgcccaccaatcacgcgagggaatggaa
cttgtcgccagtcaagcaaagccaaggcctactcctcttgacttgaagcccacgggtgca
aacagagctggcgttgccaatgcctttgagcggtatggccaagtgatgcagtcatcagtt
gctccgttgccaaatcagcatggcgccgacacattcagccgatcgaagaaatggggcaaa
ctcagagacgatgtcaagcaactgcggcttgctgactacaagacccttcttggtgtggtc
aaggccaaggtcaagggcgagaagatcaaggatgacaagactatggccatggaaaaggtc
atccagcttgtgtccaacttgcctagcaactccaagacacgcacagagctcaccaactcg
tttttgagcgagctgtggtacacccttgagcatcccccttcgatgtatgtgggtgagaag
ttccagtatcgccaggctgatgggtcatataataatgttatgtttccccagcttggtgcc
gctggcacttcgtactccagatcggtggctgccaatgtcgttcggcagggcgctcttcca
gaccccaatctcatcttcgagtcagtcatgaagcggacggagtacacagaacatccgaac
aatgtctctagcattctatggtactgggccagtatcatcattcacgatctgttctggaca
gactacagggacatgagcaagtccaagacctcttcgtacctggacctgtctcctctgtac
ggcagcaaccaggacatgcaggacaccatccgcaccttcaaggacggcaagatcaagcct
gactgctttgctgacaagcgcctcctgggcatgccacccggtgtcggtgtgtttttgatc
atgttcaaccgcgtccacaaccatgtggctgagaacttggcccgcatcaacgaggatggc
aggttttctccccccagccccaaccttgagggcgagaagaaggaggctgcgtggaagaag
tacgacaatgacctgttccagcatgctcggttgatcacctctggtctgtacatcaacatc
acactgctggattacgtccgaaacattgtcaacctcaaccgtgttgataccacctggact
cttgacccccgtgtcgagactggcataaacgttgacaccaaggagggtgccgagcgtggt
accggcaacgtgtgctcggccgagttcaacctctgctaccgctggcactcgtgcatctcg
gccaaggatgacaagtggattcaggatttctactatgatctcttcaagaagccgggcaag
gacctctctattcatgagctcatcatgggcttcggcaagttcgagggcatgatcccagat
gaccctgcggagcgtcccttcaacaagttccagagagggccggatggcaagttcaacgac
gatgaccttgtcaactgcatctcagacgccattgaggaccccgctggatcttttggcgcc
cgaaacgtgcccgagtcgatgcgggcggttgagattctcgggatcattcaaggccgcaga
tggaatgttgctggcttgaacgaattccgcaagcacttcggcctgaagccctacgagaag
ttcgaggacatcaactccgacccgggtgttgctgagtctcttcgtcgcctgtatgatcac
cccgactttgtggagctgtaccctggtctcgtggcggaggagaggaaggagcccatggtt
cctggtgtcggcattgcgcctacctacaccatctcccgtgtcgtcttgtcggatgctgtg
tgtctggtgagaggtgaccgccactacaccatcgactacacgccacgaaacctcaccaac
tggggtttcaacgaagttcagtatgacttgaacatcaaccacggttgcgtcttttacaag
ctcttcctccgggctttccccaaccacttcaagtacaactcggtctacgcgcactacccc
atggtgaccccgtcggagaacagcaagattctcaaggacctcaagcgcgctcatctcttt
gacttctcccggccaggcaggatcgccacacccaccgaggtcacctcgtacgatggtgcc
cagcgcatctttgctgctgaggacaagttcaagagcacctggaatgctggtgtcgctggc
atccgcgccaaggcgagccctgagctttctggcgatgctgctgtccacgacaggcaccgc
accactgcatctcggtcgctgttcacccctgagctgggcacccagatcaaggccttctac
gagagcttgaccgacaaactgctcaccaccaaaagctacactttggtacccggcagcaag
tttgctgaccttgtccgcgacattgccaatatcgtgccaacccactttgccgccagtgtc
ttcggccttccgttgacaaccaaggaaaacagaaagggcatctacaccgagcacgagctt
tacgccgtcctccagattatcgcctctgccctcttcgtcgactcggagcctgttaagctc
ttccccgtggtggaagcagccaagacggtggctggtcagctcggcaccctcgtcgacaag
acggtcaagagccccaaggcagccaagaacagcgtcctcaacaccttcggcgtcaacttt
atcaaggagcttaagaaggccggtttggccacgcacgacatcacttggaaccatgtcctc
cccaccgctgcggccctcgcctcgagccaaggggagctgttcacccaagcagtggattac
tacctctcccccgagggtgccgcgcacgtagcggacattaccgccattgcctcccagcct
tcatcttcccaaaacgacgctctcctcttgggttacgtcctggaaggcatccgcctgtca
ggttcagctcggtctcactttgaagccacaaccgccggcactgtcacggcgtccaatggc
acggagctgcaaatccagcccggcagcaaggttaccatcaactcttcaaccgcctcccgc
gacgcagcttacttccctgagccagaaaccgtcaacccccgccgtccactggacaagtac
atccactttgacgccggtccccatgcctttctgggcaaggagatcagccagattgccctc
acagagatgttccgtgctctgttcaagaggaagaatgtccggcgcgcgcctggtccgcag
ggagagctaaagaaggtgccgagggcggatgggaacggggtggattacctcagggaggac
tggggtgctttgacgcctttccctgttaccatgaaggtgatgtgggatgaggtttag

DBGET integrated database retrieval system