KEGG   Podospora anserina: PODANSg1268Help
Entry
PODANSg1268       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pan  Podospora anserina
Pathway
pan03030  DNA replication
pan03410  Base excision repair
pan03420  Nucleotide excision repair
pan03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PODANSg1268
   03410 Base excision repair
    PODANSg1268
   03420 Nucleotide excision repair
    PODANSg1268
   03430 Mismatch repair
    PODANSg1268
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pan03032]
    PODANSg1268
   03400 DNA repair and recombination proteins [BR:pan03400]
    PODANSg1268
Enzymes [BR:pan01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PODANSg1268
    6.5.1.6  DNA ligase (ATP or NAD+)
     PODANSg1268
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PODANSg1268
DNA replication proteins [BR:pan03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PODANSg1268
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PODANSg1268
DNA repair and recombination proteins [BR:pan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PODANSg1268
   NER (nucleotide excision repair)
    Other NER factors
     PODANSg1268
   MMR (mismatch excision repair)
    Other MMR factors
     PODANSg1268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Jak1_Phl
Motif
Other DBs
NCBI-GeneID: 6188259
NCBI-ProteinID: XP_001904250
UniProt: B2AF11
LinkDB All DBs
Position
5
AA seq 857 aa AA seqDB search
MASPAKKRKLNSDTKKAAVPATKGIQYFFAKQQQNGSSSRTTSEIQQNGSQSEKSDEQLT
DEELARKLQAEWDAEVQASNQRQQQLQPEPNTSPALPAPPSPLKLSVSPKVDTAKSKNTL
SLSSVTAVEDQVTATIPLDESPLTFDPSKYVPQLQESWAAERGKSSYALLTRCFVLVSST
QSRIKIVDTLVNCLRLLIEGDPNSLLPAVWLATNAISPPYISMELGLGGSAISKALKQVC
GLDNRALKAMHDRLGDPGDVAFEAKKKQSFTLKKPKPLTIKGVFESLVKIAKTQGQGSGD
IKQRIVDRLLQDARGGEESRYIVRTLCQHTTMLIALSRAFLLSKPPGADFPTREPAELAK
LSKEELAEIWSRGEELVKASFARHPDYNDLIPVLLDIGISDELPIRCGLNLHIPLRPMLG
SITRDLSEMLTKLQGRDFACEYKYDGQRAQVHCDADGKVSIFSRHLELMTDKYPDLVSLV
PKIRGEDVQSFIMEGEVVAVDQTTGELKNFQTLSNRARKDVAVGSITINVCLFAFDLMYL
NGQPLLDRPFRERRDMLRSLFIEIPHHFTWVKSLDATSQDSEPVLTFFKSALETKCEGIM
VKILDNLPDIPYEDQSAAAGLLDNTKPTTTTTTTNKTPLNPPPPQKRSRRKPLLSTYEPD
KRLDSWLKVKKDYSTSLSSSSEPLDLIPIAAWHGTGRKSQFWSPFLLAVRNEDVGSLEAV
CKCMSGFTDNFYKANKAYYDPAIEGRTLGKKPGFVEYYGPEPDVWFNPTEVWEVAFADVT
VSPTYTAAVGMVHPDKGLSLRFPRFVRKREDKGIEEASTSEVLAGLYRKQEAGPAKRPME
EVEKEQEEGEDIMDEDE
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccggcgaagaagaggaaactcaattccgatacgaagaaggctgcagtcccg
gcgaccaaaggaatacagtacttttttgccaagcaacagcagaatggatcgtcatcaaga
accacttctgagattcaacaaaatggttcacagtctgagaagtcggatgagcaattgact
gacgaggaactggctcggaagctgcaggctgagtgggatgcagaggtccaagcatcaaac
caaagacaacaacagcttcagccagaaccaaatacatcaccagctcttccagctcctcca
tcaccactgaagttgtccgtatcccccaaggttgatacagcaaaatccaagaacactcta
tcgctttcgtcagtcacggcagtggaagatcaagtaacagccacaataccactggatgaa
agccccttgacatttgatccatccaaatacgtcccgcagctccaagaatcatgggctgcc
gaacgcggcaagtcatcctacgccttgcttacacggtgctttgtgcttgtcagtagtacc
caaagcaggatcaagatcgtggacacgcttgtcaactgtcttcgtctacttattgagggc
gatccaaacagcctgttgcccgcagtatggctggccaccaatgccatctcacccccatac
atttccatggagcttggtctgggaggttcggctatctccaaagcactaaagcaagtatgc
ggacttgacaaccgggcgctgaaagccatgcatgacagattgggtgatccgggtgatgtt
gcctttgaggccaagaagaagcaaagcttcaccctgaaaaaaccaaagccactgaccatc
aagggtgtgtttgagtctctggtcaagattgcaaagacacaaggtcagggtagtggagac
atcaaacagcgtattgtggacagactgttgcaagatgctcgaggaggcgaggagagcaga
tatatcgtccgcactttgtgtcagcatacgactatgctgatagctctctcaagagccttt
cttctctccaagccacccggtgcggatttccctactagggagccagcagagctagcgaag
ctcagtaaggaagaactagccgagatatggtcaagaggagaggagctcgtgaaagcatca
tttgccagacatccagattataatgacctcatcccagtgcttcttgatattggcatatca
gacgagctgcccatccgctgtggtctcaacctccacatcccactccgtcccatgctaggc
agtatcacccgcgatctcagcgagatgctcaccaagcttcaggggcgagactttgcctgc
gagtacaagtacgacggccagcgcgcccaggttcactgcgatgccgacggcaaagtctcc
atcttctcccgtcacctcgagttaatgacggacaaataccccgacctcgtctccttggtg
cccaagataagaggcgaagatgtccaaagcttcatcatggaaggcgaagttgtcgccgtg
gaccaaaccaccggcgagctcaaaaactttcaaaccctctccaaccgcgccagaaaggac
gtcgccgtaggcagcataaccatcaacgtctgcctcttcgcctttgacttgatgtacctc
aacggccaacccctcctcgaccgcccctttcgcgaacgccgggacatgctccgatcactc
ttcatcgaaatcccccatcacttcacctgggtcaaaagcctagacgcgacctcacaagat
tccgaaccagtcctcaccttcttcaagtccgccttagagacaaaatgtgaggggataatg
gtgaaaattctggataacctccccgacattccctacgaggaccagtctgccgccgctgga
ctactcgacaacaccaaacccaccaccaccaccaccaccaccaacaaaacccccctcaac
cccccacccccccagaaaagatcccgccgcaaacccctcctgtcaacctacgaaccagac
aaacgcctcgactcctggctcaaagtaaaaaaggactattccacctccctgtcctcctcc
tcagagcccttggacctaatccccatcgctgcctggcacggcacaggccgcaagtcccag
ttctggtccccgttcctcctagcggtccgaaatgaggatgtaggctccctagaggcagtg
tgcaagtgcatgtccggcttcacggacaacttctacaaagctaacaaggcatattacgac
ccagcgattgaagggaggacgttggggaagaagccagggtttgtggagtattacgggccg
gaaccggacgtgtggtttaatccgacagaggtgtgggaggtggcgtttgcggatgtgacg
gttagtcctacttatactgctgctgtgggaatggtgcaccctgacaaggggttgagtttg
cggttcccgaggtttgtgaggaaacgagaggataaggggattgaggaggcgagtaccagt
gaggtgctggcaggtttgtacaggaagcaagaggctgggccggcgaagaggcccatggag
gaggtggaaaaggaacaggaggaaggggaggatatcatggacgaggatgagtga

DBGET integrated database retrieval system