KEGG   Podospora anserina: PODANSg1688Help
Entry
PODANSg1688       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pan  Podospora anserina
Pathway
pan00250  Alanine, aspartate and glutamate metabolism
pan00410  beta-Alanine metabolism
pan00430  Taurine and hypotaurine metabolism
pan00650  Butanoate metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
Module
pan_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PODANSg1688
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PODANSg1688
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PODANSg1688
   00430 Taurine and hypotaurine metabolism
    PODANSg1688
Enzymes [BR:pan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PODANSg1688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 6188910
NCBI-ProteinID: XP_001904666
UniProt: B2AKT3
LinkDB All DBs
Position
5
AA seq 531 aa AA seqDB search
MNGTNGVKKQTLDRASEVEHLIDAVKSLIIPFIQAADDAVPSRAAGELLPNRNGVVRNAL
VESKGPEELVKELALSLPQVGRGEEGLLQTIQDVLKHSVNTWDQGFMDKLYASTNPVCCC
SKTFVRQSSNSVTQVGVISELVLAVLNTNVHVYQVSPALAVIEKHTAKTFASLFGFNGPR
AGGVTCQGGSSSNLTSIVIARNTLYPESKLNGNSAAPNGPFVLFTSSHGHYSVEKAAVTC
GFGSSSVWTVPVDASGRIIPSELRRLVQKSLDQGLTPFYVNATAGTTVLGSYDPFEEISA
VCKEFNLWMHIDASWGGPAIFSAAHKHKLVGSHLADSLTVNPHKMLNCPVTCSFLLGPDM
SVFHKANTLPAGYLFHSSAPSDVWDLADLTLQCGRRADSLKLALAWIYYGAEGFGRQIEA
AFELAAYFAGLLERSGNFVLVSENPPPCLQVCFYYAPGGRLRGTGEGNTEVTRGMVERLV
RRGYMVDYAPDVSKESRGSFFRVVVNAQTLRGTVEGLVKGLEAVGREVVPQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaaccaacggggtcaagaagcagaccctcgacagggcatccgaggtggaacat
ctcattgatgctgtgaaatccttaatcatccccttcattcaggccgccgatgatgctgtg
ccatccagggctgccggggaactgctcccaaacaggaacggtgtcgtccgcaatgcccta
gtcgagtccaagggaccggaagagctggtcaaggaattggccttgtctctccctcaagta
ggccgtggcgaggagggtctcttacagacgatccaagatgtcctcaagcacagcgtcaac
acctgggaccaggggttcatggacaagctgtatgccagcaccaaccccgtatgttgctgc
tctaaaacttttgttcgtcagtcatctaactcggttacacaggtcggtgttatctccgag
ctcgtcctcgccgtcctcaacacaaatgtccacgtctaccaagtctccccagccctggca
gtaatagaaaagcacaccgccaaaaccttcgcctccctcttcggtttcaacggtccccgc
gccggcggcgtaacctgccaaggcggctcctcctccaacctcacctccatagtcatcgcc
cgcaacaccctctaccccgaatccaaactcaacggcaactccgccgcccccaacggcccc
tttgtcttgttcacctcctcccacggtcactactcggtcgaaaaagccgccgtaacctgc
ggcttcggttcctcctcagtctggaccgtccccgtcgacgccagcggcaggataatcccc
tctgaactccgccgcctcgtccaaaagtccctcgaccaaggcctcacccccttttacgtc
aacgccaccgccggcaccaccgtcttggggagctacgacccctttgaggaaatctcggcc
gtctgcaaggagttcaacctctggatgcacatcgacgcctcgtggggcggcccggccatc
ttttccgccgctcacaagcacaagcttgtcggcagtcaccttgccgattccctgactgtg
aacccgcacaagatgctcaactgtccggttacgtgctcgtttctgctggggccggacatg
tcggttttccacaaagcaaacacccttccggcggggtacctctttcacagctcggctccg
tctgacgtgtgggatttggcggatttgacgctccagtgcgggaggagggctgattcgctc
aagctggcgctggcgtggatttactacggggcggaggggtttgggaggcagatcgaggct
gctttcgagctggcggcgtattttgccgggttgctggaacggagcgggaactttgtgctg
gttagtgagaacccgccgccgtgcttgcaggtttgtttttattatgcgcctggggggagg
ttgagggggaccggggaggggaacacggaggtcacgagggggatggtggagaggttggtg
aggagggggtacatggttgattacgcgccggatgtgagcaaggagagcagggggagcttc
tttagggtggtggttaatgctcagacgttgagggggacggtggaggggttggtgaagggg
ttggaggcggtggggagggaggtggtgcctcagtag

DBGET integrated database retrieval system