KEGG   Podospora anserina: PODANSg3671Help
Entry
PODANSg3671       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pan  Podospora anserina
Brite
KEGG Orthology (KO) [BR:pan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pan03036]
    PODANSg3671
Enzymes [BR:pan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PODANSg3671
Chromosome and associated proteins [BR:pan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PODANSg3671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 6190789
NCBI-ProteinID: XP_001906638
UniProt: B2ASD6
LinkDB All DBs
Position
1
AA seq 1186 aa AA seqDB search
MASPASLSELSSRPKRTSQPQVDLQQDRPASNKDGSKSPREGDLTQSLQHLTISTTSSPA
RQPRAPRPSPLKPTSSYDYPSEISPRRPSSAMRSPLSNSSSVRSPSRAGTPALLRKASTN
SLRSVNGVTPLRRASSASILSPTPSRSARSPLRSMSPEFPEKPILTPQAVANAHFKAELD
ALHGPDWNRPAETVVILQDACYGHRFSRPKTSKAQLSTIVERPERVKACVLGVSAAYVRL
GERHQDGDFPIAPKANPAQLPTIPFRIQKSDRRLPLTSQTVTNVHGTKWMEELKIMCETA
ESKLAVNGKELQRPDIDRGANTGAPQKLHEGDLYLCAETLEALEGALGGVCDAVDAVFRP
QGPQRAFVAIRPPGHHCSGSYPSGFCWINNVHVGIMHAILSHGLTHAAIIDFDLHHGDGS
QSIAWLHNARSAGLGKNAAWWKKTSIGYFSLHDINSYPCEMGDEDKVRNASICIDNAHGQ
SIWNVHLQPWKTETDFWALYESKYSILLDKTREYLRVQTEKLRAQGVNSRAAIFLSAGFD
ASEWESPGMQRHNVNVPTEFYARLTRDVVKIAAEEGTSVEGRVISVLEGGYSDRALCSGV
LSHICGLAGDGPRAKQEVAPSGLGYEMGQKLGTVEAVKGNPPKEDRARQYDPSWWSVPEL
EALEAAISAPSVEIRKPRNVIPPTYSSPTQASAARAAVPPKNTRRSVSGFGVPNSHGHSY
RAPTPPPPDVAWTTAALELSRLLIPSGRQTDSCTHEELGAEATRARRERQFALAQGAEDA
DPQTMPVDVPPPVIVERAPTRMSLRERKTRPTYLEDEDDDRKSRRKTVAGPAVLATEKKR
PPPSRRLSTASTTASTAVSETVDSAPPLPTAPIRAGSRLEHVRSDSVASVRTNASGINVR
KIRAPAKKEPVPRAPRVSKKHVGAPAVAAPELPKSGGEGGDEVDKLAKDMKKIKITVVSK
AVRDARERERNAQAKLAATDTISVTVPTEPNENKPLLSVQPPENQTVPATPSDTESTFVS
SPPASAAENYPLPALSSPGHYQPSESPASPLYPASETFSNSAMSSVTPTFSSPVRGVSPH
RTTSTPTPMDMFVHYHPDGPTPESNVQQQQQPLQWLPPNVATPVSTMAPMKRGDLPVFSS
TGAIPFSPGPPQTPVSSPPPPVAGRVGTPAVKNSPVRNLIKKMENR
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgccggcgtcgttgtctgagttgtcctctcgtccaaagaggacctcccaacct
caagttgacctccagcaagacaggcccgcaagcaacaaagatggctcaaagagtcccaga
gagggcgacttgacccagtcgctccaacacctgaccatatcaaccacctcatcaccggca
aggcagccccgcgcccctcggcctagccccctcaagcccacctcctcgtatgattatcct
tctgagatctccccgcgtcgaccaagcagtgccatgcgcagtccgctgtccaactcttcc
tccgtcagatcaccatccagggctggcactcccgccctactaagaaaagcctcgacgaac
tcgctccgctcggtcaacggtgtaacgccactccgccgagcaagctccgccagcatcctc
tctccaaccccatcgaggtccgccagatcaccactgagaagcatgtcgcccgaatttcca
gagaagcccatcctgaccccgcaagccgtcgcgaatgcccacttcaaagccgagctagat
gctctccatgggccggactggaaccgcccggccgagacggttgtcattcttcaggatgcc
tgctacggtcacagattctcgcgaccaaaaacctcgaaagcgcagctcagcaccattgtc
gaacgaccagagagggttaaggcctgtgtcctgggtgtatcggccgcatatgtccggctg
ggcgaacgacatcaggatggggactttccaattgccccaaaggccaacccggcgcagctg
cccacaataccttttcgaatacaaaaaagcgacaggcgacttccgctaacctcccagacg
gtgaccaatgtccacggtacgaaatggatggaagagctcaagatcatgtgtgagacggcc
gaatcgaagctggccgtcaacggaaaagagctccagcgaccagatatcgaccgcggggcc
aacacgggcgctcctcaaaagcttcatgagggggatctatatctctgcgcagaaaccttg
gaggctctcgagggagcattggggggtgtatgtgatgcggtcgatgccgtgtttcgtccc
caggggccacagcgggcctttgttgccatccgaccgcctggtcaccattgctctggctcc
tatccgtcagggttctgctggataaacaatgttcatgtcggtatcatgcacgccatcctc
agccacggtctgacccacgcggcgatcatcgatttcgaccttcatcacggcgatggctcc
cagtccattgcctggctacataatgcgaggtccgctgggctgggtaagaatgcagcctgg
tggaagaaaacatcgattgggtactttagtttgcacgacatcaactcttacccgtgcgag
atgggcgatgaagacaaggttaggaacgccagcatatgcatcgacaacgcgcacggccag
agtatctggaatgttcatctgcagccatggaagacagagaccgacttttgggcattgtac
gagtccaaatactcgatcttgctagacaagactcgggagtacttgagggtccagaccgag
aaactacgtgctcagggggtgaattcaagagccgccatctttttgtctgccggttttgac
gccagcgagtgggaaagccccggcatgcaacggcacaacgtcaatgtcccgactgaattc
tatgcccgactaaccagagacgtcgtcaagattgctgccgaagagggcacaagtgtggag
gggcgggttatcagcgttctggaaggcggttacagcgatcgggctttgtgctcgggggta
ctgagccacatatgtggtctcgctggcgatggtccccgcgccaagcaggaggtagctccc
tctggacttggttacgagatgggccagaagctgggcacagtagaggctgtgaaaggaaac
ccaccaaaagaggaccgagcccgtcagtatgacccatcgtggtggtctgttccagagctt
gaagcactcgaagccgccatcagtgccccctcggttgagatcaggaagcctcgaaatgtc
attccgcccacctactcttcgccaacacaagcatcagcagctagagcagctgtgcctcca
aagaatactcgccgcagtgtgtcaggtttcggcgtaccaaacagccacggccatagttac
agggcgcctacacctcctccacctgacgttgcgtggaccacagcagctctcgaactaagc
agattgctgatcccatcaggacgacagacggacagctgcactcatgaggagcttggcgca
gaggcaactcgagcccggcgcgaacgtcagtttgccttggctcaaggtgcagaagatgca
gatccacagactatgccggttgacgttcctcctccggtgattgtagaacgagcacccacc
agaatgtcgttaagagagcgtaaaactaggccgacgtacttggaagacgaggacgatgat
cgcaaatcacgacgaaaaacagtcgccggaccagcagtgcttgctacggagaagaaaaga
ccaccccccagtcggcgacttagtactgcgtcgacaacggcgtcgacagcggtgtcggag
actgtggactcggcaccgccacttcctacagcaccgatacgtgccggctcgaggttggag
catgtcagatctgattctgtcgcaagtgttcggaccaatgcttccggaatcaatgtgaga
aaaattcgggccccagccaagaaggagcctgttcccagagccccaagagtttccaagaaa
catgttggtgcccccgctgtggcagcacccgaacttccaaagtccggtggcgagggtggt
gacgaagtcgataagctggcgaaagacatgaagaagattaagatcactgttgtgtccaag
gcggtgcgtgacgctcgggaacgggaacgaaatgcgcaagccaaacttgccgcaacagat
accatctctgtgacggtgcctaccgagccgaacgaaaataaacctctcctctcagttcaa
ccaccggaaaaccagacggttcccgccaccccatccgacactgagtccacctttgtctcg
agcccccctgcgtcagccgcagagaactaccctctgcctgccttatcatcaccaggccat
tatcaaccttcagaatcgccagcatctccgctttacccggcttctgaaaccttttccaac
tccgctatgagttctgtcactcccaccttctcgagtcccgttcgtggagtttcgccccac
aggactacctcaactccaaccccgatggatatgttcgtccattatcatcctgatggccct
acccctgagtcgaatgttcaacagcaacagcaaccactgcagtggctgcctcccaacgtg
gccactcccgtgtcgaccatggccccgatgaagagaggagatttgcccgtctttagtagc
accggggcaattcccttttcgccggggccaccccagacgcccgtatcgtcaccgcctcca
cccgtcgctgggagggtgggaacgcctgctgtgaaaaactcgccggttaggaatctgatc
aaaaagatggagaacagatag

DBGET integrated database retrieval system