KEGG   Podospora anserina: PODANSg4029Help
Entry
PODANSg4029       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pan  Podospora anserina
Pathway
pan00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PODANSg4029
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pan02000]
    PODANSg4029
Enzymes [BR:pan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PODANSg4029
Transporters [BR:pan02000]
 Other Transporters
  Pores ion channels [TC:1]
   PODANSg4029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 6191361
NCBI-ProteinID: XP_001906996
UniProt: B2ATE4
LinkDB All DBs
Position
1
AA seq 283 aa AA seqDB search
MAPQQVDTTISPSATGPALALAKQHSADHPLKLYAGWFCPFVQRAWITLQEKEIDYRYIE
INPYHKSPEFLALNPRGLIPTLVLPPGEEGKQRVLYESVIVCEYLDEQYNSGTKLLPWDP
YERARARLWVNFVEKKLVAGWYRFMQHTPDKPYSLEGVRKEFLENLKTFVREMDEEGEGW
FSEGGFGLVDVSFLPWAGRLWLMDHYKEGGVGIPKREEREGLEEGERKVWERWERWYEAV
MGRETVRGTWSEREEYIGVYKRYAEDQTGSEVGKATREGRALP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctccccaacaagtcgacacaaccatctccccctccgctacaggcccggctctcgcc
ctcgcgaaacagcactcggctgaccaccctctaaaactctacgcgggctggttctgcccc
tttgtccaacgagcctggatcactctccaagaaaaggagatcgactaccgatacatcgag
atcaacccttaccacaaatcccccgagttcctcgccctcaacccccgcggtctcatcccc
acgcttgtcctacctcccggtgaagaggggaaacagcgggtgctgtacgaaagcgtgatt
gtttgcgagtatttggacgaacagtacaactctgggacgaagctcctgccatgggacccc
tacgagagggcgagggcgaggttgtgggtgaattttgtggagaagaaattggtggcgggg
tggtataggtttatgcagcatacgcctgataagccttatagtcttgagggggtgaggaag
gagtttttggagaatttgaagacttttgtgagggagatggatgaggagggggaggggtgg
tttagtgaagggggttttgggttggtggatgtgagctttttgccttgggcggggaggttg
tggttgatggatcattataaggagggcggggtgggcattccgaagagggaggagcgggag
gggttggaggagggagagaggaaggtttgggagaggtgggagaggtggtatgaggctgtt
atggggagggaaacggtcagggggacttggagcgagagagaggagtatattggggtgtat
aagaggtatgcggaggatcagacggggagtgaggttgggaaggctacgagggaggggagg
gcgttgccttag

DBGET integrated database retrieval system