KEGG   Podospora anserina: PODANSg5128Help
Entry
PODANSg5128       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pan  Podospora anserina
Pathway
pan00730  Thiamine metabolism
pan00790  Folate biosynthesis
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PODANSg5128
   00790 Folate biosynthesis
    PODANSg5128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pan04147]
    PODANSg5128
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pan00537]
    PODANSg5128
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PODANSg5128
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PODANSg5128
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pan00537]
 Enzymes
  PODANSg5128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 6192826
NCBI-ProteinID: XP_001908093
UniProt: B2AWJ2
LinkDB All DBs
Position
7
AA seq 611 aa AA seqDB search
MSPTSKPASGERTPLLADGVPSRNSIDSLRRAEQEDAAIHGTPLSPTPTARTRTVRELLL
FSWALLATAGVIVLAVVLQHRNSTTNPPTPTDPIPIIPGDPGTGTPYPAISSLPPKKDRK
RNLIFMVSDGMGPASLSLTRTFRQHVNKLPMDDTLVLDQHFWGTSRTRSSNSWVTDSAAG
ATAFSCARKSYNGAIGMEPGFKPCGTVLEAAKRAGYKTGLVVTTDVTDATPACFASHVGY
RWQMDEIAMQEIGEGVLGRSVDLILGGGRCHFLKNSTAGSCRQDDVDVVEIGQKKHGWGY
VDDRAGFDSLKLGKNVSLPLLGLFAERDVPFEIDRRHMNDVYPSLSEMAVTALRALEEAT
KDSEKGFFLMIEGSRIDHAGHINDPAAQVREVLEYDNTFNAVLEFIEESDTEGVLVATSD
HETGGLSTAWQAPNELPVYNWHPEVLLQANASAEYLTLLLQQHMIANPVEEQQQLQDWIR
EDLVEKRLGIKDALEIEINALASNPLLAMNIFSKMVSIRARIGWSTHGHSAVDVNIYSSG
GPGTEDIRGNVENIEVGGFLRRYLDVDVDEITRELREKMVVDVKEAEMTGRDGHPEEWFV
EVDGLVGYATA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgacgtccaaaccggcgtccggggagcgcacgccgctactagcagatggagta
ccctcgcgcaactcaatcgactccctccgccgcgccgaacaagaagatgccgccatccac
ggcaccccactctcaccaacgcccaccgcccgcacccgcaccgtccgcgagctcctcctc
ttctcctgggccctcctcgcaacagccggagtaatcgtcctggcagtagtcctccaacac
cgcaacagcaccaccaacccacccacccccaccgaccccatccccatcatccccggcgat
ccaggcacgggaaccccctacccagccatctcctccctccccccgaagaaagaccgcaag
cgcaacctcatctttatggtatccgacggcatgggccctgcctccctgtctctcactcga
acattcagacagcacgtcaataagctccccatggatgacaccctcgtcttggatcagcac
ttttggggcacgtcgagaacaagatcgtcaaattcatgggtgacggactctgcggctggg
gctacggcgtttagctgtgcgaggaagagttacaacggcgctatcgggatggaacccggg
tttaagccctgcggtacggtcctcgaggctgccaaacgggcggggtacaagactggtttg
gttgtcacgacggatgtgacggatgcgacgccggcgtgttttgctagtcatgttgggtat
cgatggcagatggatgagattgcgatgcaggagattggggagggggtgttgggacggtca
gtggatttgattttggggggtgggagatgtcatttcttgaagaactctaccgcggggagt
tgcagacaggatgatgttgatgttgtggagattgggcagaagaagcatgggtgggggtat
gtggatgacagggctgggtttgactcgctcaagttggggaagaatgtgagcttgccgttg
ttggggttgtttgccgagagggatgtgccgtttgagattgaccgcaggcatatgaatgat
gtctacccaagcttaagcgagatggcggtcacggctttgagggcgttggaggaggcgacc
aaggatagtgagaagggctttttcttgatgattgaggggagcaggattgatcacgcggga
catatcaatgatccggcggcacaggtgagggaggtgttggagtatgacaatacttttaat
gccgtgttggagtttatcgaggagtcggatacggagggtgttttggttgcgacgagcgat
cacgagacgggtgggttgtcgactgcctggcaggcgccgaatgagctgcctgtatacaac
tggcatcccgaggttctgctgcaggcgaatgcctcggccgagtatctcacgctactgttg
cagcaacacatgatcgcgaacccggtcgaggagcagcagcagcttcaggactggatcagg
gaggatttggtggagaagagattggggatcaaggatgcgttggagattgagatcaatgct
ctggcgtcgaatcctttactggcgatgaatatcttttcaaaaatggtgagcatccgggcg
aggattggatggtctacccatgggcattcggccgtggatgtgaatatttatagcagcggg
gggccggggacggaggatatcaggggaaatgtggagaatattgaggtcggagggtttttg
aggaggtatttggatgtggatgtggatgagattactagggagctgagggagaagatggtg
gttgatgtgaaggaggcggagatgaccgggagggatgggcaccctgaggagtggtttgtg
gaggtggatgggctggtgggttatgctacggcttga

DBGET integrated database retrieval system