KEGG   Podospora anserina: PODANSg5625Help
Entry
PODANSg5625       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pan  Podospora anserina
Pathway
pan00020  Citrate cycle (TCA cycle)
pan00190  Oxidative phosphorylation
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01130  Biosynthesis of antibiotics
pan01200  Carbon metabolism
Module
pan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pan_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PODANSg5625
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PODANSg5625
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PODANSg5625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 6193320
NCBI-ProteinID: XP_001908590
UniProt: B2AXY9
LinkDB All DBs
Position
1
AA seq 648 aa AA seqDB search
MASSMAWRRLAAAPALPRALRTPTQRAFSTTRPAARVIANGPLRAKEASPFVSSKYPVID
HEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHKDDW
RWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSKE
YGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQDGECRGVLAYNQ
EDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTG
IYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGA
EKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTG
EVLTVDESGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTIRDNFTPG
AKLKPVEADAGAAEIEMLDKIRTADGPKSTAEIRLAMQKTMQRDVSVFRTQESLDEGVEK
INQVDQTFSQVGIKDRSMIWNSDLVETLELRNLLTCAVQTATAAANRKESRGAHAREDYP
DRDDENWMKHTLTWQKPHGKVDLKYRRVIGTTLDENECKPVPPFKRVY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctcaatggcttggagaaggttagccgctgcgccggcgcttcctcgcgctctc
agaactcctacacagagggctttttccacaactagaccagccgcccgcgttatcgccaac
gggcccctccgggcgaaggaggcatcgccattcgtgagcagcaagtaccctgtcatcgac
catgagtacgatgcgatcgttgttggtgccggtggtgccggtctccgtgccgccttcggt
ctcgctgaggccggcttcaacactgcctgcatttccaagctcttccccacgagaagtcac
acagtcgctgcccagggtggcatcaacgccgccctcggcaacatgcacaaggacgactgg
agatggcacatgtacgacacagtgaagggctccgactggctcggtgaccaggacgctatt
cattacatgacccgcgaggctcccgcttctatcatcgagcttgagaactatggctgcccc
ttctccagaaccgaggacggcaagatttaccagcgtgctttcggtggtcagtctaaggag
tacggcaaaggcggccaggcttaccgttgctgcgctgctgccgatcgtaccggtcacgct
cttctccacactctctacggccagtctctccgtcacaacaccaactacttcatcgagtac
ttcgccatcgacctgatcatgcaggatggtgagtgtcgcggtgttctcgcctacaaccag
gaggatggtaccctccaccgcttcctcgccaacaacaccgttctcgccaccggcggttac
ggccgcgcctacttctcttgcacttcggcccacacctgcaccggtgacggtatggccatg
gttgcccgtgccggtctccccaaccaggatctcgagtttgtccagttccaccctaccggt
atctatggtgccggctgcctgatcactgagggtgctcgtggtgagggtggctacctcctc
aactccgagggtgagcgtttcatggagagatatgcccctaccgccaaggatcttgcctct
cgtgacgtcgtctcccgctccatgaccatggagatccgtgacggccgtggcgtcggtgcc
gagaaggaccacatctacctccagctcagccaccttcccgccgagattcttgccgagcgt
ctccccggtatctctgagacggccggcattttcgccggtgtcgatgtccgcaagcagccc
atccccgtccttcccaccgtccactacaacatgggtggtatccccactcgctacactggt
gaggttcttaccgtcgacgagtctggcaacgacaaggtcgttcccggtctcttcgcgtgc
ggtgaggctgcttgcgtgtctgtccacggtgctaaccgtctgggtgccaactctctcctc
gacttggtcgttttcggccgcgccgttgcccacaccatccgtgacaacttcacccccggc
gccaagttgaagcccgttgaggctgatgccggtgccgccgagattgagatgctcgacaag
atccgcactgctgacggccccaagagcaccgccgagatccgtcttgccatgcagaagacc
atgcagcgcgacgtctccgtcttccgcacccaggagtcccttgacgagggtgttgagaag
atcaaccaggtcgaccagaccttctcccaggtcggcatcaaggaccgcagcatgatctgg
aactctgaccttgttgagacccttgagctccgcaacctgctcacttgcgctgtccaaacc
gccaccgccgccgccaaccgcaaggagtctcgtggcgcccacgcccgcgaggactacccc
gaccgtgacgacgagaactggatgaagcacaccctcacctggcagaagccccacggcaag
gtcgacctcaagtaccgccgtgttattggcaccaccctcgacgagaacgagtgcaagccc
gttcctcctttcaagcgtgtctactaa

DBGET integrated database retrieval system