KEGG   Podospora anserina: PODANSg6315Help
Entry
PODANSg6315       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pan  Podospora anserina
Pathway
pan00500  Starch and sucrose metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg6315
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PODANSg6315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 6193839
NCBI-ProteinID: XP_001909280
UniProt: B2AZM4
LinkDB All DBs
Position
3
AA seq 399 aa AA seqDB search
MALFAVPNIIQDLIPAAASESINPWTWNLNLNASGLYEYLPTMHALSKFALLGACAVQSV
MGLPEPVERREANLLKRNVDDWINRETPIAWEKLLCNIGPDGCAVRNQGVPAGVVVASPS
RSDPDYFYTWTRDAALVYKGLADAFRRNYTEGLHTQLKNFVSSQAKLQGVGNPAGGLNDG
QGLGEPKFMVDLKEFTGEWGRPQRDGPPLRAIALIRYAKWLVENGHKAVANAQVWPTIEN
DLKYSAQYWNQTGFDLWEEVPGSSFFTIASTHRALVEGAQLGAVLGKPTRAYTAVAPQVL
CFQQSFWNAREGFVVSNINGGEWRRGRDANSILASIHNFDPSAGCDANTFQPCSDRALSN
HKVVVDSFRSIYNINRGIAQNKAVAVGRYSEDVFYKDVA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctctcttcgccgttcccaacatcatccaggacctcatcccagcagcagcctccgag
tcaatcaacccttggacctggaacctgaacctgaacgcctctggtctctacgaatacctt
cccaccatgcacgccttgtccaagttcgccctgctgggcgcctgcgccgttcagtcggtg
atgggtctgcccgaacctgtcgagagacgtgaggccaacctcctcaagcgcaacgtcgac
gactggatcaacagagagacccccatcgcctgggagaagctcctctgcaacatcggcccc
gatggctgtgctgttcgcaaccagggtgttcccgccggtgtcgttgttgccagcccttcc
cgctccgaccctgactacttctacacctggaccagagatgccgccctcgtctacaagggc
cttgccgatgccttccgccgcaactacaccgagggtctccacacccagctcaagaacttt
gtctcctcccaggccaagcttcagggtgtcggcaacccggccggtggtctcaacgacggc
cagggtcttggtgagcccaagttcatggttgatctcaaggagttcaccggcgagtggggc
cgcccccagcgcgatggtcctcccctccgtgccattgccctgatccgctacgccaagtgg
ctcgttgagaacggccacaaggctgttgccaacgcccaggtctggcccaccatcgagaac
gatctcaagtactcggcccaatactggaaccagaccggtttcgacctctgggaggaggtt
cccggctcctccttcttcaccatcgccagcacccaccgtgccctcgtcgagggtgctcag
ctcggcgccgtcctcggcaagcccacccgtgcttacactgccgtcgcccctcaggttctc
tgcttccagcagtctttctggaacgctcgcgagggtttcgttgtctccaacatcaacggt
ggtgagtggcgccgcggccgcgacgccaactcgatcctcgcctccatccacaacttcgac
ccctccgccggctgcgatgccaacactttccagccctgctctgacagggcgctctccaac
cacaaggtcgtcgtcgactctttccgctccatctacaacatcaaccgcggcatcgcccag
aacaaggccgtcgctgttggccgctactctgaggatgtcttttacaaagacgtcgca

DBGET integrated database retrieval system