KEGG   Podospora anserina: PODANSg7791Help
Entry
PODANSg7791       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pan  Podospora anserina
Pathway
pan00052  Galactose metabolism
pan00500  Starch and sucrose metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PODANSg7791
   00500 Starch and sucrose metabolism
    PODANSg7791
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PODANSg7791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 6195577
NCBI-ProteinID: XP_001910750
UniProt: B2B450
LinkDB All DBs
Position
2
AA seq 917 aa AA seqDB search
MIGPRLLGLGLLAGLSSAAIAPKAVAVTVERPLSECPGYKASNVKTTSSGLTADLSLAGR
ACNTYGTDLEKLRLEVTYETDNRIHVKIQDTNDAVFQVPESVFPRPKGSGSNAKRSVLEF
KYKTNPFSFSVVRRKTGEVLFDTSAAPLVFESQYLRLRTKLPNNPNLYGLGEHWDPFRLN
TTNYIRTMWSQDSFATPEGANLYGSHPVYYEHRKTGTHGVFFLNSNGMDIKIDKNKSGQF
LEYNTIGGVFDFYFMAGPTPIDVARQYAEVAGLPAMMPYWGLGYHNCRYGYRDIYEVAEV
VYNYSQAQIPLEVMWTDIDYMDQRRVFSNDPERFPMPVYRSLVDHLHKNQQKYIVMVDPA
VGYADYPAYHRGVEDSIFLKRDNGSEYLGVVWPGVSVFPDWFSSNITTYWNNEFSLFFSR
DTGVDIDGLWIDMNEPSNFPCFFPCSDPFAAAVGFPPTPPPVRSHSERPLPGWPCEFQPE
GTQCKRDEVPQIAAPAARDVVPLSNPHAGPVTKWKGLPGRDLLFPKYSIHNKAAYMDSWN
ADKGGISNKTVNTNTIHENGLAEYDVHNLYGSMMSTFSSDAMLARRPGLRPLVITRSTFA
GAGASVGKWLGDNVADWAAYRGTIRAMMAFAAIYQVPMVGADVCGFAGSTTEELCARWAT
LGAFAPFYRNHNEYPPAISQEFYRWESVTKAARKAIDIRYRLLDYIYTAMHKQTVDGTPL
INPVFYLYPNDANTFGLENQYFYGPGLLVAPVTQEGSTSVEVYLPKDIFYDFYTHKKIQG
QGRTIRLANQGLSDIPLFLRGGVIVPARVKSAMTTTGVREQNFELLVPVGADGTATGTLY
LDDGVSVEQKGTTEITFRYARGVLTAKGKFGFQTKVKITKVTVIGAGKRKRDETVETTVE
VEQPLTGEFEITVGDLE
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacctcgtcttctgggtctcgggctgttggccgggctcagctcggccgccatc
gcgcccaaggctgtcgctgtcactgtcgaacgccctttgagcgagtgccctggctacaaa
gcctccaacgtcaagaccacctcatccgggctcacggccgacctgtcgctggccggtcgc
gcgtgcaacacctacggaacggacttggagaaactccgtctcgaggtcacctacgagact
gataaccgcatccacgtcaagattcaggacaccaacgatgctgtcttccaggtcccggaa
tctgtgtttcctcgtcccaagggctctggatcgaacgctaagcggtcggtgttggagttc
aagtacaagacgaatcccttttcgttctcagtcgtccggcgcaagaccggtgaggttctg
tttgacacatccgccgcccccctcgtcttcgagtcccagtacctgcgcctgagaaccaag
cttcccaacaaccccaacctgtatggcctcggtgagcactgggatccgttccgtctcaat
accaccaactacatccgcacgatgtggtcccaggactcgtttgccacgcctgagggggca
aatttgtatggcagccatcccgtgtactacgagcacaggaagacgggcactcacggcgtc
tttttcctcaactccaacggcatggacatcaagatcgacaagaacaaatcaggacagttc
ctcgagtacaacaccatcggaggcgtgtttgacttttacttcatggccggcccaaccccg
atcgacgttgcgcgccagtatgccgaggtcgcgggactccccgccatgatgccgtactgg
ggtctgggttaccacaactgcaggtatggctaccgtgacatctatgaggtcgccgaggta
gtatacaactacagccaagcccagattcccctcgaggtcatgtggacagatatcgactac
atggaccagagaagggtattttccaacgaccccgagaggttcccgatgcccgtctaccga
agtcttgttgaccacctccacaagaaccagcagaaatacatcgtgatggtcgatcccgct
gtcggatacgccgattatcctgcttatcatcgtggtgtcgaggacagcatctttctcaag
cgcgacaacggatccgagtatcttggtgtcgtctggcctggtgtctccgtctttcctgac
tggttctcttcgaacattaccacgtactggaacaacgagttttctctgttcttctccaga
gacaccggtgtcgatatcgacggcctctggatcgacatgaacgagccctccaatttcccc
tgcttcttcccctgcagcgatcccttcgcggctgccgtcggtttcccgcccaccccgcca
cctgtgcgcagccactccgagcgccctctcccaggctggccgtgtgaattccagccagag
ggcacccagtgcaagcgcgatgaagtgccccagatcgcggctccagctgctcgggatgtt
gtccccctcagcaacccccacgccggtcccgtgaccaagtggaagggtcttcccggtcgt
gacctgttgttccccaagtattccatccacaacaaggccgcctacatggattcgtggaac
gctgacaagggcggcatctccaacaagaccgtgaacacaaacaccattcacgagaacggc
ctcgccgagtacgatgtccataacctttacggctccatgatgtcaaccttttccagcgat
gccatgcttgccagacgtcccggtcttcgccccctggtcatcactcgttccacctttgcc
ggcgccggcgcttcagtcggcaagtggctgggagacaacgttgccgactgggctgcttat
cgcggaaccatccgagccatgatggcatttgccgccatctaccaggttcccatggtcggt
gctgatgtgtgcggtttcgctggctcgaccacggaggagctctgcgcccgctgggccacc
cttggtgccttcgctccgttctaccgcaaccacaacgagtacccccctgccatctcgcag
gagttctaccgctgggagagcgttaccaaggccgcccgcaaggccattgatatccgctac
cgccttctcgattacatctataccgccatgcacaagcagaccgttgacggcacccccctc
atcaaccccgtcttctacctgtaccccaacgacgccaacacgttcggccttgagaaccag
tacttctatggccctggcctcctcgtggcacctgtcacccaggagggctccaccagcgtc
gaggtgtacctccccaaggatatcttctatgatttctacacccacaagaagatccagggt
caaggtcgcaccatccgcctcgcgaatcaaggtctgtccgacattcccctcttcctccgg
ggcggtgttattgttccagcccgcgtcaagtcggccatgaccaccaccggggtccgcgag
cagaactttgagcttctcgtgcccgttggtgccgatggcactgccacaggtactctctac
cttgatgacggtgttagcgtcgagcagaagggcactaccgagattactttccgctacgcc
cgcggtgtcttgacggccaagggcaagtttggcttccagaccaaggtcaagatcaccaag
gtcaccgtcattggagctggcaagcgcaagagagatgagacggtcgagacgacggtggag
gttgagcagccgctcactggggagtttgagattaccgttggcgatttggagtaa

DBGET integrated database retrieval system