KEGG   Podospora anserina: PODANSg8556
Entry
PODANSg8556       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K17646  5'-oxoaverantin cyclase / versicolorin B synthase [EC:4.2.1.142 4.2.1.143]
Organism
pan  Podospora anserina
Pathway
pan00254  Aflatoxin biosynthesis
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PODANSg8556
Enzymes [BR:pan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.142  5'-oxoaverantin cyclase
     PODANSg8556
    4.2.1.143  versicolorin B synthase
     PODANSg8556
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Pyr_redox_3 FAD_binding_2 DAO Pyr_redox_2 NAD_binding_8 Lycopene_cycl Pyr_redox Thi4 HI0933_like TrkA_N NAD_binding_9
Other DBs
NCBI-GeneID: 6195886
NCBI-ProteinID: XP_001911514
UniProt: B2B6B4
LinkDB
Position
2
AA seq 645 aa
MRSLPLYLVALSRTISVGIATATQQPLYLSAFNAIPRVSSLFTTTKNHDEARMDGRIQAK
DLLSSHFGPYGWPGQSFDYVIVGGGTAGLAMAKRLSEDNANSVAVIEAGGFYEIEGGNMT
EVPMYLFNYFFDNGHVKNPLFDWYQYTVPQPGLAKRAMFYMQGKTLGGSTARGAMLYHRG
SKGAYKKWAEQVGDDAYTWDNWLPYFQKSVKFSGPNTNPRPANATAVNNLSAFSESGGPV
HVAYPYWTNAISSWVDKALAKLGFPEVQGFSDGNLLGRSYITHTINPYTRRRETASTSYL
HDALLESNNLNFYTRTLVKKILFDDKKKATGVKVSTDGFEWTIGAKKEVILSAGVMRSPQ
LLMVSGIGPRDTLEKLDIPVLSDRPGVGKNMQDTIILGPTSPVKVESHSQLMGSKETLPR
SIYEYNNFRTGLLTNPGQDYFAFEKHQPGMLKDSTAADIEKEFPEDWPTFSYIALDDTFV
PQYDGKNYFSMSAALMATFSRGSVTINSTDTAQNPIVDPRWLDDPRDKEMAVAAFRRCRA
IVASETMQEVIDGPEILPGERYQTDEEIYNYIAETSDAYYAGVGTCAMGKRDDPNAVVDS
NARVLGVDGVRVVDASAFPFAIDGQPMGTVYALAEKIAADILAGK
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgagatccctgccactctacctcgtcgccctgtcgcggacaatcagcgttggcattgcc
actgcaacacagcagccgctgtatctctctgccttcaatgctattcctcgagtctcgtcc
ctgttcaccacgacaaaaaatcatgatgaagctcgcatggatggtcgtatccaggcaaaa
gacttgcttagctcgcacttcgggccctacggttggccagggcaatcattcgactacgtg
attgttggcgggggcactgctggcttagcgatggccaagcgactttccgaagacaacgcc
aactcggtggctgtgatcgaagcaggcggtttctacgagattgaggggggaaatatgacc
gaggtgcccatgtatctgttcaactacttcttcgataatggccacgtgaagaaccccttg
tttgactggtatcagtacactgtgccacagccaggtctcgccaaaagagccatgttttac
atgcagggaaagacactaggtggcagcacagcccgcggcgcgatgctctatcaccgcggc
tcaaaaggggcctataagaaatgggccgagcaggtcggtgacgatgcatacacctgggac
aactggctgccgtacttccagaaaagcgtaaagttttccggccccaacacaaacccaaga
cctgccaatgccactgccgtcaacaacctttctgcattctccgagtccggcgggccagtc
cacgtcgcctacccctactggactaacgccatctcatcctgggtggacaaggcactcgcc
aaactgggctttcccgaagtgcaaggcttctccgacggcaacctgctcggccggtcctac
atcacgcacaccatcaacccttacacccggcgccgcgagacagcatccacctcctacctc
cacgacgccctcctcgagagcaacaacctcaacttttacactcgcacccttgtcaagaag
atcttattcgacgacaagaaaaaggcaaccggcgtcaaggtgagcaccgacggcttcgag
tggaccattggcgccaaaaaagaagtcatcctctccgccggcgtgatgcgctccccccag
ctcctgatggtctcgggcatcggaccccgggacaccctcgagaagctcgacatccccgtc
ctctccgaccgccccggcgtcggcaagaacatgcaagacaccatcatcctcggcccgacc
agcccggtaaaagtagaaagccacagccagctgatgggcagcaaggagaccctcccccgg
tccatctacgagtacaacaacttccgcaccgggctgctgaccaaccccgggcaggactac
tttgcctttgagaagcaccagcccggcatgctcaaggactcgacggcggcagatatcgaa
aaagaattccctgaggactggccgactttttcctacattgccttggacgacacgtttgtc
ccacagtatgatgggaagaattactttagcatgtcggcggcgctgatggcgacgttcagt
cgggggtcggtgacgattaacagtactgatacggcgcagaatccgattgttgatccccgt
tggttggacgatccgagggataaggagatggctgttgctgcgtttcgccggtgcagggct
attgtggcgtcggagacgatgcaagaggtgattgatgggccggagattctgcctggggag
aggtatcagactgatgaggagatttacaattatattgctgagacgtcggatgcgtattac
gctggtgtggggacttgcgctatggggaagagggatgatccgaatgcggtggtggactcg
aatgcgagggttttgggggtggatggtgttcgggtggtggatgcgtcggcgttcccgttt
gcgattgatgggcagcctatggggacggtgtacgcattggcggagaagattgctgctgat
attttggctggaaagtga

DBGET integrated database retrieval system